Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate BPHYT_RS29175 BPHYT_RS29175 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >FitnessBrowser__BFirm:BPHYT_RS29175 Length = 390 Score = 300 bits (769), Expect = 3e-86 Identities = 168/355 (47%), Positives = 222/355 (62%), Gaps = 6/355 (1%) Query: 6 IRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDILIGER 65 +RN+ + G ++ +D+ +++GEF+VLLG SGCGKSTLL+ IAGL + + G I I Sbjct: 39 VRNLTIQLGANTVIENLDLDVQAGEFVVLLGPSGCGKSTLLHSIAGLIDVTDGSIEIAGE 98 Query: 66 SVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARLLQIEN 125 + PKDR IA+VFQSYALYP +SV RN+ F L + P+AE + V + +LQ+ Sbjct: 99 DMTWADPKDRRIALVFQSYALYPTMSVERNLSFALRINGTPKAEIARRVARASEMLQLGP 158 Query: 126 LLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLHQMLRT 185 LL RKP+QLSGGQRQRVAIGRA+VR VFLFDEPLSNLDAKLR E+R ELK+LHQ L Sbjct: 159 LLKRKPAQLSGGQRQRVAIGRAIVREADVFLFDEPLSNLDAKLRTELRRELKQLHQRLGA 218 Query: 186 TVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMNILDAE 245 T++YVTHDQ+EAMTLATR+AVMR G I+Q P EVY RP L+VA F+G+P MN++ Sbjct: 219 TMIYVTHDQVEAMTLATRMAVMRGGVIQQFGTPAEVYARPDNLFVATFLGTPAMNLIKGR 278 Query: 246 MTANGLKIEGCEEVLPLPAA---FNGAAWAGRRVKVGIRPEALRLAAGSEAQRLTASVEV 302 + + C E L + F G +G+R E +RLA G+ A V + Sbjct: 279 LETRDGALHFCTEHWRLDVSRYPFRTTPANGLPCVLGVRAEDVRLAEGASEH---AKVSL 335 Query: 303 VELTGPELVTTATVGSQRITACLPPRTAVGMGSAHAFTFDGTALHLFDPESGRSL 357 VE G V ++ + +T + +G A AF+FD T + LFD G L Sbjct: 336 VEPMGNHRVIWLDYHGVQVASIDQTKTPLAIGDAAAFSFDSTHVSLFDEAGGARL 390 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 390 Length adjustment: 30 Effective length of query: 330 Effective length of database: 360 Effective search space: 118800 Effective search space used: 118800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory