Align Glucosamine kinase GspK; GlcN kinase; EC 2.7.1.8 (characterized)
to candidate BPHYT_RS19060 BPHYT_RS19060 ATPase
Query= SwissProt::Q9KUA9 (294 letters) >FitnessBrowser__BFirm:BPHYT_RS19060 Length = 293 Score = 135 bits (339), Expect = 1e-36 Identities = 89/282 (31%), Positives = 139/282 (49%), Gaps = 5/282 (1%) Query: 3 YYVGIDGGGTSCRARIRNQQGEWVGEAKSGSANIMLGVEVALRSVVDAITQAAEQGGLSP 62 + +GIDGGG+ R + + QG + +A SG + + LGVE A +++ +A G + Sbjct: 6 FLIGIDGGGSGTRVVLGDAQGRELAQAASGPSGLGLGVERAWQAIAAGCGEAFASAGKAL 65 Query: 63 DDFPSMHVGLALAGAEQKEAWHAFMQQAHPFASITLNTDAYGACLGAHLGEEGAIMIAGT 122 D + +G LAG ++ AF QA A + + +DAY LGAH G G I+ GT Sbjct: 66 D-WSRCVLGCGLAGVNNRDWLAAFRAQAPALAGLAVESDAYTTLLGAHGGAHGVIVALGT 124 Query: 123 GSCGILLKG-GKQYVVGGREFPISDQGSGAVMGLRLIQQVLLAQDGIRPHTPLCDVVMNH 181 GS +L G G+ V G FP D+ SGA +GLR+I A DG P L ++ H Sbjct: 125 GSVAAVLDGEGECRQVSGYGFPSGDEASGAWLGLRVIVHAQQALDGRGPIDDLARALVAH 184 Query: 182 FN-HDIDSIVAWSKTALPRDYGQFSPQIFSHAYCGDPLAIELLKQTAADIEMFLIALHHK 240 HD DS+V W A Y + +P + +H P A LL + A++ + AL Sbjct: 185 TGAHDRDSLVVWLCEANQTAYARLAPILIAHR--THPFAARLLGEAGAEVGKMITALDPS 242 Query: 241 GAERICLMGSIAERIQDWLSPPVQQWIVKPQSDAIEGALMFA 282 + + L G + +++++ Q + +P +D+ G L A Sbjct: 243 ASLPVALCGGLGAPLREYVPQIYQARLREPLADSAHGGLQLA 284 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 293 Length adjustment: 26 Effective length of query: 268 Effective length of database: 267 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory