GapMind for catabolism of small carbon sources

 

Aligments for a candidate for edd in Burkholderia phytofirmans PsJN

Align Phosphogluconate dehydratase; 6-phosphogluconate dehydratase; EC 4.2.1.12 (characterized)
to candidate BPHYT_RS25650 BPHYT_RS25650 dihydroxy-acid dehydratase

Query= SwissProt::P21909
         (607 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS25650 BPHYT_RS25650
           dihydroxy-acid dehydratase
          Length = 588

 Score =  197 bits (501), Expect = 1e-54
 Identities = 162/495 (32%), Positives = 236/495 (47%), Gaps = 44/495 (8%)

Query: 101 GATVQVAGGVPAMCDGVTQGQPGMEESLFSRDVIALATSVSLSHGMFEGAALLGI--CDK 158
           G  V + G   ++ DG +    GM  SL SR+V+A   SV L        AL+G+  CDK
Sbjct: 70  GGGVPIRGSAISVSDGTSMNHSGMRMSLVSREVVA--DSVELFVRAHNYDALIGVAGCDK 127

Query: 159 IVPGLLMGALRFGHLPTILVPSGPMTTGIP------------NKEKIRIRQLYA-----Q 201
            +PG+LMG +R  ++P + +  G M  G+              ++   +  + A     +
Sbjct: 128 TLPGILMGMVRV-NVPGVFLFGGAMLPGVAPGQLPGGAGTGLQRQSTILTTIEAVGTTQR 186

Query: 202 GKIGQKELLDMEAACYHAEGTCTFYGTANTNQMVMEVLGLHMPGSAFVTPGTPLRQALTR 261
           G + + +L  +E  C    G+C    TANT  MV E LGL   GSA V      R A+ R
Sbjct: 187 GDMSRAQLDAIEKQCTPTAGSCPGQFTANTMAMVAETLGLAPLGSAMVPAVYSERIAIAR 246

Query: 262 AAVHRVAELGWKGDDYRPLGK-IIDEKSIVNAIVGLLATGGSTNHTMHIPAIARAAGVIV 320
            A   V  +  +G    PL + ++  +S+ NA   + ATGGSTN  +HIPAIA  AG+  
Sbjct: 247 RAGETVMRILTQGG---PLPRDLVTMESLENACAAVAATGGSTNAALHIPAIANEAGIRF 303

Query: 321 NWNDFHDLSEVVPLIARIYPNGPRDINEFQNAGGMAYVIKELLSANLLNRDVTTIAKGGI 380
             +D   +   +PLI  + P G     +  +AGG+  V+  LL+   L+ DV     G +
Sbjct: 304 ALDDVQRVFAKIPLIGDLQPGGRYLAQDLHHAGGVPAVLNALLAGGFLHGDVPAFGGGTL 363

Query: 381 EEYAKAPALNDAGELVWKPAGEPGDDTILRPVSNPFAKDGGLRLLEGNLGRAMYKASAVD 440
            E     AL+         A    D  ++RP   P  ++GGL +L GNL           
Sbjct: 364 AE-----ALS---------AFSGPDGIVVRPCDEPLGENGGLVILRGNLAPDGACLKIAG 409

Query: 441 PKFWTIEAPVRVFSDQDDVQKAFKAGELNKDVIVVVRFQGPRAN-GMPELHKLTPALGVL 499
            K  +    VRVF  ++D      A +  +  ++V+R +GP+   GM E+  +T A+   
Sbjct: 410 LKSLSFTGAVRVFECEEDCMAVVAARDYREGDVLVIRNEGPKGGPGMREMLGVTAAI-YG 468

Query: 500 QDNGYKVALVTDGRMSGATGKVPVALHVSPEALGGGAIGKLRDGDIVRISVEEGKLEALV 559
           Q  G KVAL+TDGR SGAT  + +  +V PEA  GG IG LR+ D V I    G L   +
Sbjct: 469 QGMGEKVALLTDGRFSGATRGMCIG-YVGPEAAAGGPIGLLRNDDRVHIDARAGILRVDL 527

Query: 560 PADEWNARPHAEKPA 574
             DE  AR  A+ PA
Sbjct: 528 SDDEL-ARRRADAPA 541


Lambda     K      H
   0.318    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1047
Number of extensions: 62
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 607
Length of database: 588
Length adjustment: 37
Effective length of query: 570
Effective length of database: 551
Effective search space:   314070
Effective search space used:   314070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory