Align Sugar ABC transporter permease (characterized, see rationale)
to candidate BPHYT_RS29180 BPHYT_RS29180 sugar ABC transporter permease
Query= uniprot:A0A165KQ00 (289 letters) >FitnessBrowser__BFirm:BPHYT_RS29180 Length = 306 Score = 299 bits (766), Expect = 5e-86 Identities = 143/277 (51%), Positives = 199/277 (71%) Query: 13 RFLVYAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSACTG 72 R VYA L A FFLLPLY MLVTS K EIR +LLA P SAW AWQSACTG Sbjct: 30 RLGVYAFLLTAALFFLLPLYVMLVTSVKPMNEIRLGNLLAFPTHFTLSAWSAAWQSACTG 89 Query: 73 VDCNGLRPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQV 132 +DCNG++ F NSV + VP+ ++S GA+NGY LS W+ RG+ LFG+LL G F+P QV Sbjct: 90 LDCNGIQVGFWNSVRIVVPSTILSIAIGAVNGYALSFWRPRGAGLLFGVLLMGAFIPVQV 149 Query: 133 VLLPMSQVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGASFF 192 ++ P+ +VL + L SS+ G+V++H + G+ TL FRNYY +IP+EL AAR+DG F+ Sbjct: 150 MVYPLVRVLASVHLFSSLPGIVVIHTIFGMPVMTLLFRNYYVSIPQELFKAARIDGGGFW 209 Query: 193 QIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLANTSSSVKA 252 +IF +++LP+STPI++V +I Q T IWNDF+ G+VF+GT + P+TV LNN+ NT++ + Sbjct: 210 RIFVQLMLPMSTPIIVVAVIMQVTGIWNDFILGLVFAGTKNLPMTVQLNNIINTTTGERL 269 Query: 253 YNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 YNV+MAA I+ + + +Y ++G++FVRG+ +GAVKG Sbjct: 270 YNVNMAATILTSMVPLAVYFVSGRWFVRGIASGAVKG 306 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 306 Length adjustment: 26 Effective length of query: 263 Effective length of database: 280 Effective search space: 73640 Effective search space used: 73640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory