Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate BPHYT_RS24135 BPHYT_RS24135 alpha-dehydro-beta-deoxy-D-glucarate aldolase
Query= SwissProt::P23522 (256 letters) >FitnessBrowser__BFirm:BPHYT_RS24135 Length = 266 Score = 319 bits (817), Expect = 4e-92 Identities = 152/248 (61%), Positives = 191/248 (77%) Query: 7 PNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALK 66 PN F+ A+ + IGCW++L++PI TE+LG+ GFDW++LD EHAPND+ T IPQLMALK Sbjct: 11 PNSFRRAVCGGETLIGCWASLASPIVTELLGIVGFDWMLLDAEHAPNDVLTLIPQLMALK 70 Query: 67 GSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVS 126 SASAPVVR P N+ V IKRLLD GF NFL+PFVE+ ++A AVA+TRYPP+GIRGVSVS Sbjct: 71 DSASAPVVRPPANDSVFIKRLLDSGFSNFLVPFVESADDAARAVAATRYPPQGIRGVSVS 130 Query: 127 HRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALGH 186 HR N + TV DYF+ +N N+ ++VQIES++ VD +D I A +GVD +FVGPSDLAAA G Sbjct: 131 HRGNHYATVPDYFSVANDNVCVIVQIESRKAVDAIDEILAVDGVDAVFVGPSDLAAAYGQ 190 Query: 187 LGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSA 246 LGNA+H DVQ AI H+F RA A GKPSGILAPV+ADA RY+ G VAV +D+G+ + A Sbjct: 191 LGNANHSDVQAAIAHVFERAQAAGKPSGILAPVQADAERYISMGCRVVAVCADMGLLKGA 250 Query: 247 TQKLADTF 254 Q + F Sbjct: 251 AQTVQKHF 258 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 266 Length adjustment: 25 Effective length of query: 231 Effective length of database: 241 Effective search space: 55671 Effective search space used: 55671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate BPHYT_RS24135 BPHYT_RS24135 (alpha-dehydro-beta-deoxy-D-glucarate aldolase)
to HMM TIGR03239 (garL: 2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03239.hmm # target sequence database: /tmp/gapView.10179.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03239 [M=249] Accession: TIGR03239 Description: GarL: 2-dehydro-3-deoxyglucarate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-128 411.0 0.8 1.1e-127 410.8 0.8 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS24135 BPHYT_RS24135 alpha-dehydro-beta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS24135 BPHYT_RS24135 alpha-dehydro-beta-deoxy-D-glucarate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.8 0.8 1.1e-127 1.1e-127 1 248 [. 12 259 .. 12 260 .. 0.99 Alignments for each domain: == domain 1 score: 410.8 bits; conditional E-value: 1.1e-127 TIGR03239 1 nrfrqkllarktliglwsalgnpitaevlglagfdwllldgehapndvltlipqlmalkdsasapvvrvp 70 n fr+++ ++tlig+w++l++pi +e+lg+ gfdw+lld+ehapndvltlipqlmalkdsasapvvr+p lcl|FitnessBrowser__BFirm:BPHYT_RS24135 12 NSFRRAVCGGETLIGCWASLASPIVTELLGIVGFDWMLLDAEHAPNDVLTLIPQLMALKDSASAPVVRPP 81 78******************************************************************** PP TIGR03239 71 lnepviikrlldigfynllipfvesaeeaeravaatryppegirgvsvaqrsnrygtvadyfkkindnit 140 +n+ v ikrlld gf n+l+pfvesa++a+ravaatrypp+girgvsv++r n+y+tv+dyf + ndn++ lcl|FitnessBrowser__BFirm:BPHYT_RS24135 82 ANDSVFIKRLLDSGFSNFLVPFVESADDAARAVAATRYPPQGIRGVSVSHRGNHYATVPDYFSVANDNVC 151 ********************************************************************** PP TIGR03239 141 vlvqiesrkgvdavdeiaavdgvdgvfvgpsdlaaalgylgnpnhpdvqkairhifdraaahgkavgila 210 v+vqiesrk vda+dei avdgvd+vfvgpsdlaaa+g lgn+nh dvq+ai h+f+ra+a+gk++gila lcl|FitnessBrowser__BFirm:BPHYT_RS24135 152 VIVQIESRKAVDAIDEILAVDGVDAVFVGPSDLAAAYGQLGNANHSDVQAAIAHVFERAQAAGKPSGILA 221 ********************************************************************** PP TIGR03239 211 pveadarrylelgatfvavgsdlgvfrsatkalsekfk 248 pv+ada ry+ +g + vav +d+g+++ a+++++++f lcl|FitnessBrowser__BFirm:BPHYT_RS24135 222 PVQADAERYISMGCRVVAVCADMGLLKGAAQTVQKHFM 259 *********************************99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (266 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 5.12 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory