Align tartronate semialdehyde reductase 2 (characterized)
to candidate BPHYT_RS24130 BPHYT_RS24130 tartronate semialdehyde reductase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__BFirm:BPHYT_RS24130 Length = 297 Score = 377 bits (968), Expect = e-109 Identities = 187/290 (64%), Positives = 227/290 (78%) Query: 2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIFI 61 K GFIGLGIMG PMA NL + G L T V D+L+ GAV+ ++ V +D+IFI Sbjct: 3 KAGFIGLGIMGKPMAANLLKNGVALAAFTRSGVPDDLVQAGAVACDSPAAVGAQADVIFI 62 Query: 62 MVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSG 121 MVPDTP VE VLFGE G G+T+VDMSSISP+ T+ FA +V E G DYLDAPVSG Sbjct: 63 MVPDTPDVERVLFGEQGLASVLRAGQTVVDMSSISPMATREFAARVRESGADYLDAPVSG 122 Query: 122 GEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNIE 181 GE+GA+ G+L+IMVGG+ A F+ VKPLF+++GKN+TL+GG G GQ CKVANQ+IVA IE Sbjct: 123 GEVGAKAGSLTIMVGGETATFDAVKPLFDMMGKNVTLIGGVGAGQVCKVANQVIVAATIE 182 Query: 182 AVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLNL 241 AV EALL ASKAG DP RVR+ALMGGFASSRILEVHGERM KRTF+PGF+I LHQKDLNL Sbjct: 183 AVGEALLLASKAGVDPARVREALMGGFASSRILEVHGERMTKRTFDPGFRIELHQKDLNL 242 Query: 242 ALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291 AL +A++L ++LPNTATCQ LFN C A+GG DHSA+V+ALE +A+H++ Sbjct: 243 ALSTAQSLGVSLPNTATCQALFNACVAHGGKAWDHSAMVRALEFLADHEI 292 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 297 Length adjustment: 26 Effective length of query: 266 Effective length of database: 271 Effective search space: 72086 Effective search space used: 72086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS24130 BPHYT_RS24130 (tartronate semialdehyde reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.1432.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-126 405.3 7.3 8.1e-126 405.1 7.3 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS24130 BPHYT_RS24130 tartronate semiald Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS24130 BPHYT_RS24130 tartronate semialdehyde reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.1 7.3 8.1e-126 8.1e-126 1 291 [] 3 292 .. 3 292 .. 0.99 Alignments for each domain: == domain 1 score: 405.1 bits; conditional E-value: 8.1e-126 TIGR01505 1 kvgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqve 70 k gfiGlGimGkPm+ nllk G l ++t+ + d+l+ aGa++ ++ ++v +advi++mvPd+P+ve lcl|FitnessBrowser__BFirm:BPHYT_RS24130 3 KAGFIGLGIMGKPMAANLLKNGVALAAFTRS-GVPDDLVQAGAVACDSPAAVGAQADVIFIMVPDTPDVE 71 789***************************9.99************************************ PP TIGR01505 71 evalGenGileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtlsimvGGdka 140 v++Ge+G+ + G+++vdmssi+P++++e+a v+e G d+ldaPvsGGe+ga+ g l+imvGG+ a lcl|FitnessBrowser__BFirm:BPHYT_RS24130 72 RVLFGEQGLASVLRAGQTVVDMSSISPMATREFAARVRESGADYLDAPVSGGEVGAKAGSLTIMVGGETA 141 ********************************************************************** PP TIGR01505 141 vfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGlag 210 fd vkpl++++gk+++l+G+ GaGq++kvanqviva ieav eal+la+kaGvdp +v++al+GG+a+ lcl|FitnessBrowser__BFirm:BPHYT_RS24130 142 TFDAVKPLFDMMGKNVTLIGGVGAGQVCKVANQVIVAATIEAVGEALLLASKAGVDPARVREALMGGFAS 211 ********************************************************************** PP TIGR01505 211 stvleakkerlldrdfkPGfridlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhsalv 280 s++le+++er+ +r+f+PGfri+lhqkdl+lal +a+++g++lP+ta+++ l++a+ a+G+ dhsa+v lcl|FitnessBrowser__BFirm:BPHYT_RS24130 212 SRILEVHGERMTKRTFDPGFRIELHQKDLNLALSTAQSLGVSLPNTATCQALFNACVAHGGKAWDHSAMV 281 ********************************************************************** PP TIGR01505 281 raleklakdkv 291 rale la++++ lcl|FitnessBrowser__BFirm:BPHYT_RS24130 282 RALEFLADHEI 292 *******9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.79 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory