Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate BPHYT_RS24645 BPHYT_RS24645 amino acid ABC transporter permease
Query= TCDB::P48244 (228 letters) >FitnessBrowser__BFirm:BPHYT_RS24645 Length = 218 Score = 100 bits (248), Expect = 3e-26 Identities = 70/211 (33%), Positives = 109/211 (51%), Gaps = 14/211 (6%) Query: 3 TLWADLGPSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNT 62 TLW D+ +LL A T+ L++ + +G I G IL MRVSP+ LR + Y+ + T Sbjct: 5 TLW-DIARNLLLAARWTVLLSLIAFVGGGIVGLILLAMRVSPIAWLRRIVVVYVEVFQGT 63 Query: 63 PLTLVVLFCSFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINT 122 PL L+ LF +F GL L G + S ++ A + LYTS ++ + R + Sbjct: 64 PL-LMQLFLAF-----FGLPLLGVDVSPWVA------ATVTLTLYTSAYLVDIWRGCVEA 111 Query: 123 VHFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASL 182 V GQ A SLG+ FG R I++PQA + A+ P L+ + K+T +AS+IG E + Sbjct: 112 VPRGQWSAGASLGMTFGQQLRYIVWPQARKIAVAPTVGFLVQVVKSTALASIIGFTELT- 170 Query: 183 LMKATIENHANMLFVVFAIFAVGFMILTLPM 213 I N A F ++ + A+ + + P+ Sbjct: 171 KTGTMITNAAFRPFPIYGMVAMIYFAMCFPL 201 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 218 Length adjustment: 22 Effective length of query: 206 Effective length of database: 196 Effective search space: 40376 Effective search space used: 40376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory