Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate BPHYT_RS03015 BPHYT_RS03015 aldolase
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__BFirm:BPHYT_RS03015 Length = 270 Score = 184 bits (466), Expect = 2e-51 Identities = 111/266 (41%), Positives = 154/266 (57%), Gaps = 8/266 (3%) Query: 7 RSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTPEARVLVR 66 RS LFVP RPER KAL + AD V++DLEDAV K AR L+R+L R++VR Sbjct: 4 RSYLFVPGDRPERFTKALDTNADAVVIDLEDAVAPAAKQAAREGLQRWLSAADVRRLIVR 63 Query: 67 INAAEHPGHADDLALCRDHAGVIGLLLPKVESAAQVRHAA--VASGKPVWPIVESARGLA 124 +NA P H DD+ + +G+ ++LPK +SA Q+ A + S + ++E+ G+ Sbjct: 64 VNAVGTPWHLDDVDMV-SASGLSTMMLPKSDSAWQLAEVAARLPSQMRIVALIETVAGVV 122 Query: 125 ALGEIAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAPPLDG 184 A+ EIA A V RL+FG++D D +G L + R +++++R AGL P+DG Sbjct: 123 AMREIAGAPSVMRLAFGTVDFCGD----AGIEGLGVELDYVRSQMVIESRYAGLPAPIDG 178 Query: 185 VYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRV-AEAGA 243 V + + A L E V AR GFGG LCIHP QV+P++ PS E WA RV A Sbjct: 179 VTLELDDLARLTEHVATARRFGFGGKLCIHPRQVDPVNGGFAPSENERRWASRVLAACRE 238 Query: 244 SGAGVFVVDGEMVDAPVLGRARRLLE 269 G F VDG++VD PV+ RARR+ E Sbjct: 239 HPEGAFAVDGKLVDRPVIERARRIAE 264 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 270 Length adjustment: 25 Effective length of query: 250 Effective length of database: 245 Effective search space: 61250 Effective search space used: 61250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory