Align Tonoplast intrinsic protein-a (transports water, urea, glycerol and gases (CO2 and NH3) (characterized)
to candidate BPHYT_RS19040 BPHYT_RS19040 aquaporin Z
Query= TCDB::Q9XG70 (247 letters) >FitnessBrowser__BFirm:BPHYT_RS19040 Length = 246 Score = 90.5 bits (223), Expect = 3e-23 Identities = 71/227 (31%), Positives = 108/227 (47%), Gaps = 24/227 (10%) Query: 21 LIVEFICTFLFVFAGVGSAMAANKLNGDPL----VSLFFVAMAHALVVAVTISAGFRISG 76 L+ E TF V G GSA+ A G P+ + V++A L V A ISG Sbjct: 7 LVAELFGTFWLVLGGCGSAVLAANFAG-PVHGLGIGFVGVSLAFGLTVLTMAFAIGHISG 65 Query: 77 GHLNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTAGLETPVHTLANGVS- 135 HLNPAV++GL + G + Y + QL+ +V +L+ + +G + +A+G + Sbjct: 66 CHLNPAVSVGLTVAGRFPARDLLPYIVAQLIGAVLGALVLSLIASG-KPGFDLVASGFAS 124 Query: 136 --YGQ----------GIIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIM 183 YG+ I EV++T LF + + K G P+ GL + + Sbjct: 125 NGYGERSPGHYSLAAAFICEVVMTGFFLFVI---LGSTDKRAPAGFAPIAIGLCLTLIHL 181 Query: 184 AGGPFSGASMNPARSFGPA-FVSGIWTDH-WVYWVGPLIGGGLAGFI 228 P + S+NPARS GPA FV G D W++WV P++G +AG + Sbjct: 182 ISIPVTNTSVNPARSTGPALFVGGAAMDQLWLFWVAPILGAVIAGVL 228 Score = 27.3 bits (59), Expect = 3e-04 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Query: 20 ALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALVVAVTISAGFRISGGHL 79 A I E + T F+F +GS P+ + + H + + VT ++ + Sbjct: 140 AFICEVVMTGFFLFVILGSTDKRAPAGFAPIAIGLCLTLIHLISIPVTNTS--------V 191 Query: 80 NPAVTLG--LCMGGHITVFRSILYWIDQLLASVAACAL 115 NPA + G L +GG + + L+W+ +L +V A L Sbjct: 192 NPARSTGPALFVGG-AAMDQLWLFWVAPILGAVIAGVL 228 Lambda K H 0.327 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 247 Length of database: 246 Length adjustment: 24 Effective length of query: 223 Effective length of database: 222 Effective search space: 49506 Effective search space used: 49506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory