Align PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 (characterized)
to candidate BPHYT_RS27950 BPHYT_RS27950 dihydroxyacetone kinase
Query= SwissProt::Q9CIV7 (192 letters) >FitnessBrowser__BFirm:BPHYT_RS27950 Length = 210 Score = 108 bits (270), Expect = 7e-29 Identities = 72/188 (38%), Positives = 109/188 (57%), Gaps = 21/188 (11%) Query: 18 IQENKAYLSELDGPIGDGDHGANMARGMSETMKA---LEVSNFGNVSEIFKKVAMTLMSK 74 ++E+ ++ LD IGDGDH N+ RGM + +E FG +I A ++S Sbjct: 17 LKEHTDEIASLDQQIGDGDHIFNLLRGMEALLAVRAEIEAEAFGPALDI---AASKVLST 73 Query: 75 VGGASGPLYGSAFLAMSK-TAIETLDTS---ELIYAGLEAIQKRGKAQVGEKTMVDIW-- 128 VGG+SGPL+ S M+K +AI +D + + AG+EA+ +RGK VG KTM+D+ Sbjct: 74 VGGSSGPLFFSLLNGMAKASAINAMDVAGFAHIFAAGVEAVGQRGKTGVGSKTMMDVLIP 133 Query: 129 -SAFLNDLQTDSASK----DNLEKVVK----ASAGLLATKGRASYLGERSIGHIDPGTQS 179 + +L +SA+ D L ++ + A+ +LATKGRAS+LGERS GHIDPG +S Sbjct: 134 VAKRFEELAAESAAARVVLDTLPQIAEENMLATRDMLATKGRASFLGERSRGHIDPGARS 193 Query: 180 SAYLFETL 187 S + ++ Sbjct: 194 SQIMIASV 201 Lambda K H 0.312 0.129 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 192 Length of database: 210 Length adjustment: 21 Effective length of query: 171 Effective length of database: 189 Effective search space: 32319 Effective search space used: 32319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory