Align glycerone kinase (EC 2.7.1.29) (characterized)
to candidate BPHYT_RS32475 BPHYT_RS32475 dihydroxyacetone kinase
Query= BRENDA::P76014 (210 letters) >FitnessBrowser__BFirm:BPHYT_RS32475 Length = 567 Score = 120 bits (301), Expect = 5e-32 Identities = 66/186 (35%), Positives = 106/186 (56%), Gaps = 3/186 (1%) Query: 26 LTGLDREIGDADHGLNMNRGFSKVVEKLPAI-ADKDIGFILKNTGMTLLSSVGGASGPLF 84 LT +D+ +GD D G++++RG ++ +L A+ +L++ TL VGG SGPL+ Sbjct: 382 LTDMDQRVGDGDLGISLSRGARAILHELDDYPAETTPAAVLRSMSATLRRVVGGTSGPLY 441 Query: 85 GTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQS 144 +RAA A + T +E F G DG++ G A PGD+TM D P ++L+ + Sbjct: 442 AVMLVRAAVALEQSGGSTPKEWAVAFSAGVDGLMELGGAHPGDRTMVDALKPAADALQSA 501 Query: 145 SEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQML 204 + ++ AL+AA + A T +M R+GR+SY+G+R++GH DPGA +V + + Sbjct: 502 LARQDALDAALQAAVDAVSAGASQTASMHPRRGRSSYVGDRALGHVDPGAHAVALWLAAI 561 Query: 205 --ALAA 208 ALAA Sbjct: 562 REALAA 567 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 567 Length adjustment: 29 Effective length of query: 181 Effective length of database: 538 Effective search space: 97378 Effective search space used: 97378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory