Align glycerol facilitator-aquaporin (characterized)
to candidate BPHYT_RS16500 BPHYT_RS16500 MIP family channel protein
Query= CharProtDB::CH_012828 (289 letters) >FitnessBrowser__BFirm:BPHYT_RS16500 Length = 237 Score = 150 bits (380), Expect = 2e-41 Identities = 92/282 (32%), Positives = 139/282 (49%), Gaps = 50/282 (17%) Query: 9 YITEFVGTALLIIMGNGAVANVELKGTKAHAQSWMIIGWGYGLGVMLPAVAFGNIT-SQI 67 YI EF+GTAL++++G+GAVANV L TK ++I G+ + V + + + + + Sbjct: 4 YIAEFIGTALVVLLGDGAVANVLLARTKGKGADLIVIVMGWAMAVFIAVYVTASFSGAHL 63 Query: 68 NPAFTLGLAASGLFPWAHVAQYIIAQVLGAMFGQLLIVMVYRPYYLKTQNPNAILGTFST 127 NP T+ LA +G F WA V YI AQ+LG M G LL+ + YR ++ K + + LG F T Sbjct: 64 NPVVTISLALAGKFAWAKVPGYIAAQMLGGMAGALLVWIAYRQHFAKEGDADVKLGVFCT 123 Query: 128 IDNVDDNSEKTRLGATINGFLNEFLGSFVLFFGAVAATNIFFGSQSITWMTNYLKGQGAD 187 + + + L E + +FVL G + YL Sbjct: 124 ---------SPAIRSVPHNLLTEMIATFVLILGVL-----------------YLASPQVG 157 Query: 188 VSSSDVMNQIWVQASGASASKMIAHLFLGFLVMGLVVALGGPTGPGLNPARDFGPRLVHS 247 + + D L +G LV+G+ ++LGGPTG ++PARD PRL+H+ Sbjct: 158 LGALDA-------------------LPVGLLVLGIGISLGGPTGYAMSPARDLSPRLMHA 198 Query: 248 LLPKSVLGEAKGSSKWWYAWVPVLAPILASLAAVALFKMIYL 289 LLP K S W YAW+PV P+L AA L+ +++ Sbjct: 199 LLPI----PGKRDSDWHYAWIPVCGPLLGGAAAACLYLYLHV 236 Lambda K H 0.323 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 289 Length of database: 237 Length adjustment: 25 Effective length of query: 264 Effective length of database: 212 Effective search space: 55968 Effective search space used: 55968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory