Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate BPHYT_RS08560 BPHYT_RS08560 cysteine ABC transporter substrate-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >FitnessBrowser__BFirm:BPHYT_RS08560 Length = 264 Score = 128 bits (322), Expect = 1e-34 Identities = 79/260 (30%), Positives = 135/260 (51%), Gaps = 12/260 (4%) Query: 1 MNLRRNLLLASLAAAAFCTTGAQAQD--------NVLRVGTDATFPPMEF-VENGKRTGF 51 + L + +L+A L A+F A A D LR+G + TFPP +G+ G+ Sbjct: 3 IGLLKKILVAGLIGASFTAVAAHADDLLDQVKQRGTLRIGLEGTFPPFNSKAPSGELVGY 62 Query: 52 DIELVEAIAKTMGKQVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSY-Y 110 D+++ +A+A +G + E+V ++ G+I GL + +FD+ V+ + ITD RK+ +DF+ +Y Y Sbjct: 63 DVDIAKAVAAKLGVKPEFVTTEWSGIIAGLQANKFDVIVNQVGITDARKQALDFSPAYTY 122 Query: 111 AGGLVVMVKADNKAINKLADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEMFNLV 170 + ++ K D + L DL GKK+ V +GT + + + P + E + Sbjct: 123 SAAQLIQRKDDTRQFKSLDDLKGKKLGVGLGTNYMD-MAKSVPGIDVKTYPGAPEYLRDL 181 Query: 171 DIGRADAAVTGK-PAAFQYVRTRPGLRVLDEQLTTEEYGMALRKDTPELTKAVNGAITKL 229 GR DAA+ + A+ ++ LR G+ RK P+ KA++ A+T+L Sbjct: 182 AAGRLDAALNDRLMLAYLMKNSQLPLRTGANVGAGNPSGIPFRKGNPKFAKAIDDAMTQL 241 Query: 230 KADGTYAAIVKKWFSNSAAK 249 +ADGT++ I KWF +K Sbjct: 242 EADGTFSKISDKWFGIDVSK 261 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 264 Length adjustment: 24 Effective length of query: 225 Effective length of database: 240 Effective search space: 54000 Effective search space used: 54000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory