Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate BPHYT_RS35100 BPHYT_RS35100 ABC transporter substrate-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >FitnessBrowser__BFirm:BPHYT_RS35100 Length = 263 Score = 113 bits (282), Expect = 4e-30 Identities = 76/245 (31%), Positives = 129/245 (52%), Gaps = 8/245 (3%) Query: 7 LLLASLAAAAFCTTGAQAQDNVLRVGTDATFPPMEF-VENGKRTGFDIELVEAIAKTMGK 65 L A AA AF T+ + LR+G D ++PPM+ +G GFD++L I K + Sbjct: 12 LSTALSAALAFSTSAFAVEPTTLRLGIDPSYPPMDAKAPDGSFKGFDVDLGNEICKRIHA 71 Query: 66 QVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNKAI 125 + +WV+++F G+IP L +++ D +S++ IT++R++ + F+ + ++ + + Sbjct: 72 RCQWVELEFSGMIPALQARKIDAILSSMAITEKREQQILFSSKLFQFKSRLIARQGSALA 131 Query: 126 NKLADLDGKKVSVQVGTKSVSYLTEKF-PKVQRVEVEKNQ-EMFNLVDIGRADAAVTGK- 182 L GK++ VQ GT+ Y + + P V K+Q E+F + GR D A+ G Sbjct: 132 GGTNALAGKQIGVQSGTQFEGYALKNWAPLGAHVVAYKSQDEVFADLQNGRLDGALLGSV 191 Query: 183 PAAFQYVRT--RPGLRVLDEQLTTEE--YGMALRKDTPELTKAVNGAITKLKADGTYAAI 238 A ++RT G + E L+ + G+ LRKD + ++N AI + DGTYA I Sbjct: 192 EADIGFLRTPAGKGFAFVGEPLSMGDRGVGIGLRKDETAVQASINAAIASMLKDGTYAQI 251 Query: 239 VKKWF 243 KK+F Sbjct: 252 AKKYF 256 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 263 Length adjustment: 24 Effective length of query: 225 Effective length of database: 239 Effective search space: 53775 Effective search space used: 53775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory