Align Histidine transport system permease protein HisM (characterized)
to candidate BPHYT_RS13290 BPHYT_RS13290 cysteine ABC transporter permease
Query= SwissProt::P0AEU3 (238 letters) >FitnessBrowser__BFirm:BPHYT_RS13290 Length = 225 Score = 125 bits (313), Expect = 9e-34 Identities = 72/212 (33%), Positives = 117/212 (55%), Gaps = 10/212 (4%) Query: 20 FTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLFTYIFRGTPLYVQLLVFY 79 + G+ T+ L ++S IG LA +A+ R+ K+ + + ++FRG+PL VQL V + Sbjct: 17 YAGLVFTVPLTLISFAIGLALAFLVALVRLFGPKWAVAIVRFYVWLFRGSPLLVQLFVIF 76 Query: 80 SGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAY 139 G+ + IV L ++ +LN AY +E+ G I S+P G+ EAA + Sbjct: 77 YGLPNVGIVLDP----------LTAAIIGFSLNVGAYNSEVIRGVIESIPKGQWEAAYSM 126 Query: 140 GFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQP 199 G + + R ILP A R+ALP SN I ++ T+LA TVP++ + A+ I + TY+P Sbjct: 127 GMTREQALRRAILPQAARVALPPLSNSFIALVKDTSLAAVLTVPEVFQAAQRIASVTYEP 186 Query: 200 FTAFGIAAVLYLIISYVLISLFRRAEKRWLQH 231 + AA++YL+ S VL S R E+++ +H Sbjct: 187 LILYTEAALVYLVFSSVLSSAQVRLERKFGRH 218 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 225 Length adjustment: 23 Effective length of query: 215 Effective length of database: 202 Effective search space: 43430 Effective search space used: 43430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory