Align Formiminoglutamase (EC 3.5.3.8) (characterized)
to candidate BPHYT_RS21925 BPHYT_RS21925 formimidoylglutamase
Query= reanno::Koxy:BWI76_RS08725 (318 letters) >FitnessBrowser__BFirm:BPHYT_RS21925 Length = 320 Score = 216 bits (551), Expect = 4e-61 Identities = 132/319 (41%), Positives = 177/319 (55%), Gaps = 14/319 (4%) Query: 6 PTPAALWQGRDDSAEAANALRLFQTIVRAERFEPEMLA-GDIALL-GFACDEGVRRNKGR 63 P +W GR D E + R+F IV F+ + A GD ++ GF DEGVRRN+GR Sbjct: 4 PFDDKMWAGRSDDGEPGDTRRVFNQIVP---FDGSLRAHGDTTVVVGFGSDEGVRRNQGR 60 Query: 64 TGAERGPETLRRALANMASHDGHDRCVDMGTIHVADDALEAAQQALREAVTACQRAGKRT 123 TGA P+ LRRALA + + + D G + D LE AQ L ++ +G R Sbjct: 61 TGAAHAPKELRRALAGLPAKNSMAMLADAGDVACDDGDLEGAQAELANVISEVLASGGRP 120 Query: 124 LVLGGGHETAFGHGAGVL---------DAFPGEEVGIINLDAHLDLRIADRASSGTPFRQ 174 LV GGGHE A+ G++ ++ ++ IIN DAH DLR A+SGTPF Q Sbjct: 121 LVFGGGHEVAWATYCGLVLHQHRREADESATPRKLLIINFDAHFDLRQKRPANSGTPFDQ 180 Query: 175 LALACEAQRRAFHYACIGVSRAANTQALLDEAARRGVTIIEDLDVLNAFEARAIPELARN 234 +A C +R F+Y C G+S NT +L A R GV D+D+ + EL Sbjct: 181 IANDCAERRVPFNYVCFGISDLGNTASLFVHAQRLGVRYALDVDMQETQLPLRLQELDLM 240 Query: 235 IARYDRLYLTIDLDVLPAREMPAVSAPAALGIPLATLLRIVEPLCRSGKLQAVDLVEFNP 294 + D +YLTIDLDVLPA P VSAPAALG+PL + +V + SGKL+A D+ E+NP Sbjct: 241 LDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMVRRVRGSGKLRAADIAEYNP 300 Query: 295 QYDIDSQGARAAARLAWQI 313 D D + ARAAARLA+++ Sbjct: 301 SLDQDRRTARAAARLAYRL 319 Lambda K H 0.322 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 320 Length adjustment: 28 Effective length of query: 290 Effective length of database: 292 Effective search space: 84680 Effective search space used: 84680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS21925 BPHYT_RS21925 (formimidoylglutamase)
to HMM TIGR01227 (hutG: formimidoylglutamase (EC 3.5.3.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01227.hmm # target sequence database: /tmp/gapView.19618.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01227 [M=307] Accession: TIGR01227 Description: hutG: formimidoylglutamase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-92 296.2 0.0 1.5e-92 296.1 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS21925 BPHYT_RS21925 formimidoylglutama Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS21925 BPHYT_RS21925 formimidoylglutamase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 296.1 0.0 1.5e-92 1.5e-92 1 304 [. 10 318 .. 10 320 .] 0.93 Alignments for each domain: == domain 1 score: 296.1 bits; conditional E-value: 1.5e-92 TIGR01227 1 lqgrldleeaskkrrdeqvakvvdlveledaqdekgvaliGvaldkgvirnkGrtGAkeaPsairqalan 70 + gr d e ++ rr+++ + + d + l ++ ++++G+ +d+gv+rn+GrtGA +aP+ +r+ala+ lcl|FitnessBrowser__BFirm:BPHYT_RS21925 10 WAGRSDDGEPGDTRRVFNQIVPFDGS-L--RAHGDTTVVVGFGSDEGVRRNQGRTGAAHAPKELRRALAG 76 77888888888999998888888874.3..456667899******************************* PP TIGR01227 71 lgdlvasealyDlGdivlegddlvdaqkevaqavaelladarvvvllGGdneiayatikalaqa....ak 136 l++ + + +l+D+Gd+ ++++dl+ aq+e+a+++ e+la++ ++++ GG++e+a+at+ +l+ + lcl|FitnessBrowser__BFirm:BPHYT_RS21925 77 LPAKNSMAMLADAGDVACDDGDLEGAQAELANVISEVLASGGRPLVFGGGHEVAWATYCGLVLHqhrrE- 145 ************************************************************987743331. PP TIGR01227 137 gek.......riGvinfDAHfDlRavederptsGTpfrqlldeeqaed..fhlivlGirrfsntqalfdy 197 + +infDAHfDlR+ + sGTpf q+++ + + f++++ Gi+ ++nt++lf + lcl|FitnessBrowser__BFirm:BPHYT_RS21925 146 --AdesatprKLLIINFDAHFDLRQKR--PANSGTPFDQIANDCAERRvpFNYVCFGISDLGNTASLFVH 211 ..13446777788***********998..999************999999******************** PP TIGR01227 198 akkkgvryvtddalaelsletikdileefldevDfiyltvdlDVldaasAPGvsApaagGleleellelv 267 a+++gvry +d ++e++l+ ++ l+ +lde D +ylt+dlDVl+aa APGvsApaa G+ l +++e+v lcl|FitnessBrowser__BFirm:BPHYT_RS21925 212 AQRLGVRYALDVDMQETQLPLRLQELDLMLDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMV 281 ********************************************************************** PP TIGR01227 268 kriaasdkvrgveivEvnPtlDaddrTarlaArlvah 304 +r+ s+k+r ++i+E+nP+lD d rTar+aArl lcl|FitnessBrowser__BFirm:BPHYT_RS21925 282 RRVRGSGKLRAADIAEYNPSLDQDRRTARAAARLAYR 318 *********************************9765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory