Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate BPHYT_RS07585 BPHYT_RS07585 N-formylglutamate amidohydrolase
Query= reanno::BFirm:BPHYT_RS07585 (271 letters) >FitnessBrowser__BFirm:BPHYT_RS07585 Length = 271 Score = 552 bits (1423), Expect = e-162 Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MTASNTPPVFSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAK 60 MTASNTPPVFSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAK Sbjct: 1 MTASNTPPVFSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAK 60 Query: 61 RMGASILAPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETT 120 RMGASILAPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETT Sbjct: 61 RMGASILAPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETT 120 Query: 121 RRRDAYWKPYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS 180 RRRDAYWKPYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS Sbjct: 121 RRRDAYWKPYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS 180 Query: 181 AVAGLAEEMAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEH 240 AVAGLAEEMAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEH Sbjct: 181 AVAGLAEEMAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEH 240 Query: 241 MPYAYDETLAAKVEPLLEALVVKALERVKTA 271 MPYAYDETLAAKVEPLLEALVVKALERVKTA Sbjct: 241 MPYAYDETLAAKVEPLLEALVVKALERVKTA 271 Lambda K H 0.317 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 271 Length adjustment: 25 Effective length of query: 246 Effective length of database: 246 Effective search space: 60516 Effective search space used: 60516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate BPHYT_RS07585 BPHYT_RS07585 (N-formylglutamate amidohydrolase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.27514.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-109 350.5 0.0 3.4e-109 350.3 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS07585 BPHYT_RS07585 N-formylglutamate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS07585 BPHYT_RS07585 N-formylglutamate amidohydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 350.3 0.0 3.4e-109 3.4e-109 3 258 .. 10 265 .. 8 270 .. 0.97 Alignments for each domain: == domain 1 score: 350.3 bits; conditional E-value: 3.4e-109 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidvn 72 ++++rG++Pllis+Ph Gt+++ ++++ ++ aa+ + d+dWh+++ly+fa+ +Ga++++ ++ r+vid+n lcl|FitnessBrowser__BFirm:BPHYT_RS07585 10 FSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAKRMGASILAPTYARYVIDLN 79 6789****************************************************************** PP TIGR02017 73 rdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgkiv 142 r+p+ga lypgq ttgl+P +tfd eply dG+ P+eae ++r++ y+kPyh+al+ e++ l+a hgk++ lcl|FitnessBrowser__BFirm:BPHYT_RS07585 80 RPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETTRRRDAYWKPYHEALQGELAALKAKHGKVL 149 ********************************************************************** PP TIGR02017 143 lydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcaka.kglssvlnGrfkGGyitrhygq 211 l++ahsirs++Pr+feG+lPdfn Gt +g+s+ +la++++a +++ g++ v nGrfkGGyitr+ygq lcl|FitnessBrowser__BFirm:BPHYT_RS07585 150 LWEAHSIRSHVPRFFEGRLPDFNFGTSNGASAVAGLAEEMAATVEQYdGGYTAVANGRFKGGYITREYGQ 219 **************************************999988765168******************** PP TIGR02017 212 PqngvhavqlelaqrgyleeetePvaydeakaealravlkelleall 258 P++gvha+qlel+q +y+e e +P+ayde+ a+++ +l+ l+ ++l lcl|FitnessBrowser__BFirm:BPHYT_RS07585 220 PSQGVHALQLELSQITYME-EHMPYAYDETLAAKVEPLLEALVVKAL 265 ******************9.9******************99987665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory