Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate BPHYT_RS23145 BPHYT_RS23145 putrescine/spermidine ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS23145 Length = 387 Score = 171 bits (433), Expect = 2e-47 Identities = 90/234 (38%), Positives = 142/234 (60%), Gaps = 6/234 (2%) Query: 36 DQVLAETGCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGED 95 + V+ + G V++++LSI E+F ++G SG GKSTL+R L TSG I VDGED Sbjct: 33 ENVVKKFGDSTAVDNVNLSIAKNELFALLGSSGCGKSTLLRMLAGLETVTSGRIFVDGED 92 Query: 96 ILQLDMDALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINT 155 + A+ ++R ++M+FQS+ L PH SV N+A+GLK G K ER +N Sbjct: 93 LA-----AMPPYKR-PVNMMFQSYALFPHMSVEANIAFGLKQEGTPKNEIKERVADALNL 146 Query: 156 VGLKGYENKYPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQ 215 V + Y + PHQLSGG +QRV LAR+L ++L+DE SALD IR + Q +L+ + Sbjct: 147 VQMSKYAQRKPHQLSGGQQQRVALARSLVKRPKLLLLDEPMSALDKKIRQKTQLELVNII 206 Query: 216 KTLHKTIVFITHDLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 + + T V +THD +EA+ + R+A++ +G+++Q+G+P ++ P + F+ Sbjct: 207 EKVDVTCVMVTHDQEEAMTMAGRLAVMSEGRIVQIGSPSQVYEFPNSRFSAEFI 260 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 387 Length adjustment: 28 Effective length of query: 248 Effective length of database: 359 Effective search space: 89032 Effective search space used: 89032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory