GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Burkholderia phytofirmans PsJN

Align Peroxisomal bifunctional enzyme; PBE; PBFE; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 (characterized)
to candidate BPHYT_RS13545 BPHYT_RS13545 3-hydroxyacyl-CoA dehydrogenase

Query= SwissProt::Q08426
         (723 letters)



>FitnessBrowser__BFirm:BPHYT_RS13545
          Length = 706

 Score =  476 bits (1224), Expect = e-138
 Identities = 288/712 (40%), Positives = 409/712 (57%), Gaps = 42/712 (5%)

Query: 7   LHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGF 66
           L   + L+ + + PVNA+S  + R +   ++ A  D  ++A++I GA   F AGADIR F
Sbjct: 14  LRGKVLLVTIDHAPVNALSADVRRGLLAAIEAADADKAVEAVLIVGAGRNFIAGADIREF 73

Query: 67  SAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVT 126
             P     +L  V + I+   KPVVAAI G A GGGLE+AL  HYRIA   A++GLPEV 
Sbjct: 74  GKPPV-PPSLPDVCNRIEACTKPVVAAIHGAALGGGLEVALAAHYRIAVDGAKLGLPEVQ 132

Query: 127 LGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPV-EEAIRFA 185
           LGLLPGA GTQ  PRL G  AALDLI SGR   A EAL  G++D++ +SD +  E + + 
Sbjct: 133 LGLLPGAGGTQRTPRLIGAQAALDLILSGRHASAKEALAFGLIDRLGSSDDILAEGLAYV 192

Query: 186 QRVSDQPLESRRL-----CNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAA 240
             +       RR       +    SL  + +  +E   K R    G  +    V AV+AA
Sbjct: 193 HELLAAHAPVRRTRDAAALSDRAASLAAVATARAETAKKSR----GLFSPLKIVDAVEAA 248

Query: 241 VQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSV 300
           ++ P++ G++ E +LFL  + S Q   L +AFFAER+  K         + A  R ++++
Sbjct: 249 IEQPFDEGLRVERKLFLECIDSPQRAGLIHAFFAEREVLK-----APETRAAKPRTLNTI 303

Query: 301 GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHP--- 357
           GVVG GTMG GI ++   A +PV  ++ D   LA     I  V +   +K + S      
Sbjct: 304 GVVGGGTMGAGIAVAVLDAGLPVTMIERDDASLARGRAHIEKVYDGLIAKGRLSAEKKAA 363

Query: 358 ----WSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSAL 413
               WSG     ++S   L G DLVIEAVFE++++K+ VFAEL  VCK  A L TNTS L
Sbjct: 364 LMSRWSG-----STSYDALAGADLVIEAVFEDLAVKQAVFAELDRVCKAGAVLATNTSYL 418

Query: 414 DVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVV 473
           D+D +ASS  RP  VIG HFFSPA++MKLLEV+  +  S   +AT   L+KK++K  V  
Sbjct: 419 DIDALASSVSRPADVIGLHFFSPANIMKLLEVVVPKQVSADVVATAFELAKKLRKTPVRA 478

Query: 474 GNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKS 533
           G C GF+GNR+L  Y + A  ++E+G+ P ++D  +  FGF MGPF+V DLAG D+GW +
Sbjct: 479 GVCDGFIGNRVLAVYRSAADAMMEDGASPYQIDAAVRAFGFPMGPFQVVDLAGGDIGWAA 538

Query: 534 RKGQGLTGPTLLPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPD 593
           RK +  T           +    RY  I D LCE G FGQK+G+G+Y Y +   R   PD
Sbjct: 539 RKRRAAT-----------RNPAARYVQIADRLCERGWFGQKSGRGFYLYPEG-SRSGTPD 586

Query: 594 PWLSKFLSRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHG 653
           P +   +   R    I PR+ + +EI+ R + ++INE   ++ E IA  P  +DV +L+G
Sbjct: 587 PEVEAIIDAERARAGITPRSFTDEEIIRRYMAAMINEGANVVHERIALRPLDVDVTFLYG 646

Query: 654 YGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQG 705
           YG+PR++GGPM YA  VGLP +L  ++++ +++P     +PS  L +L  +G
Sbjct: 647 YGFPRYRGGPMKYADMVGLPKILADIREFAKEDPLF--WKPSPLLIELVERG 696


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1141
Number of extensions: 65
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 723
Length of database: 706
Length adjustment: 39
Effective length of query: 684
Effective length of database: 667
Effective search space:   456228
Effective search space used:   456228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory