Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate BPHYT_RS02230 BPHYT_RS02230 acetyl-CoA acetyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2982 (397 letters) >FitnessBrowser__BFirm:BPHYT_RS02230 Length = 397 Score = 523 bits (1346), Expect = e-153 Identities = 264/389 (67%), Positives = 314/389 (80%) Query: 6 DPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGVASDSVDEVLFGCVLPAGL 65 DPIVIV RTPM FQG+ +LTAPQLG+ AI+AAV+RAG+ + VDEV+ GCVLPAGL Sbjct: 7 DPIVIVGVARTPMAAFQGDFAALTAPQLGSVAIEAAVKRAGLKPEQVDEVVMGCVLPAGL 66 Query: 66 GQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESMSNA 125 GQAPARQAALGAGL +T TT+NKMCGSGM AA+ AHDML AGS DV+VAGGMESM+NA Sbjct: 67 GQAPARQAALGAGLPLATGSTTVNKMCGSGMRAAMFAHDMLAAGSVDVIVAGGMESMTNA 126 Query: 126 PYLLDRARAGYRMGHGRVQDSMFLDGLEDAYDKGRLMGTFAEDCAETNGFSREAQDAFAI 185 PYLL +AR G RMGHG+V D MF DGLEDAY+KGRLMGTFAE+CA + F+REAQDAFA+ Sbjct: 127 PYLLPKARNGMRMGHGQVIDHMFYDGLEDAYEKGRLMGTFAEECAASFDFTREAQDAFAV 186 Query: 186 ASTTRAQQAIKDGSFKAEIVPLTVTVGKEQVVISNDEQPPKARLDKIASLKPAFREGGTV 245 S RA++A +DGSF EI P+ V K V I DEQP KA +KI +LKPAF + GTV Sbjct: 187 ESLNRAKRANEDGSFGWEIAPVKVESRKGDVTIDRDEQPFKANPEKIPTLKPAFSKTGTV 246 Query: 246 TAANSSSISDGAAALVLMRQSQAQKQGLKPLAVIHGHAAFADTPGLFPVAPIGAIKKLMK 305 TAANSSSISDGAAALV+MR+S A++ G++P+A + GH+ FA P F AP+GAI+KL + Sbjct: 247 TAANSSSISDGAAALVMMRESTARRLGVEPIARVVGHSTFAQEPAKFTTAPVGAIRKLFE 306 Query: 306 KTGWSLNDVDLVEVNEAFAVVGMAAMTHLEIPHEKLNVHGGACALGHPIGASGARILVTL 365 K GW ++VDL EVNEAFAVV MAAM +PHEK+NV+GGACALGHPIGASGARILVTL Sbjct: 307 KNGWRADEVDLYEVNEAFAVVTMAAMKEHHLPHEKVNVNGGACALGHPIGASGARILVTL 366 Query: 366 LSALRQKGLKRGVAAICIGGGEATAMAVE 394 + AL+++GLKRGVA +CIGGGEATAM +E Sbjct: 367 IGALKKRGLKRGVATLCIGGGEATAMGIE 395 Lambda K H 0.318 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 397 Length adjustment: 31 Effective length of query: 366 Effective length of database: 366 Effective search space: 133956 Effective search space used: 133956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory