Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate BPHYT_RS03230 BPHYT_RS03230 acetyl-CoA acetyltransferase
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__BFirm:BPHYT_RS03230 Length = 399 Score = 358 bits (920), Expect = e-103 Identities = 195/395 (49%), Positives = 268/395 (67%), Gaps = 8/395 (2%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 +++A IV+ +RTP+GKA +G RPD+L +K + + G + I+D IIGCA P Sbjct: 5 LQDAYIVAASRTPIGKAPRGMFKNTRPDELLVHAIKSAVAQVPGLDTKVIEDAIIGCAIP 64 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 EAEQGLN+AR LAGLP +V +TVNR+C+SGL ++A AA++I +G D IAGG ES Sbjct: 65 EAEQGLNVARMGALLAGLPNSVGGVTVNRFCASGLTALAMAADRIRVGESDAMIAGGCES 124 Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMS--MGHTAEQVAKKYGVSREDQDAFAVRSHQNAA 177 MS VPMMG+ + + ++ + ++ MG TAE+VA+++ +SRE QDAF+V SH+ A Sbjct: 125 MSMVPMMGNKPSMSPHIFDRNEDVGIAYGMGLTAEKVAERWKISREAQDAFSVESHRRAI 184 Query: 178 KALAEGKFKDEIVPVEVTVTEIGEDHKPME---KQFVFSQDEGVRPQTTADILSTLRPAF 234 A G+F DEI T+TE D E K S DEG R +T+ + L+ LR F Sbjct: 185 AAQQAGEFNDEIAAY--TITERFPDLATGEVRVKTREVSLDEGPRAETSLEGLAKLRAVF 242 Query: 235 SVDGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEA 294 + G+VTAGNSSQTSDGA A++++ + L PL +F SFAV GVPPE+MGIGP EA Sbjct: 243 ANKGSVTAGNSSQTSDGAGALIVVSEKMLKEFNLTPLARFVSFAVRGVPPEIMGIGPKEA 302 Query: 295 IPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGT 354 IP ALK AGL++ D+ ELNEAFA+Q++ VI++LG+D K+N GGAIALGHPLG TG Sbjct: 303 IPAALKAAGLKIDDLDWIELNEAFAAQSLAVIQDLGLDPAKINPLGGAIALGHPLGATGA 362 Query: 355 KLTLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 +++H ++RRN ++G+VTMC+G GMGAAG+ E Sbjct: 363 IRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIE 397 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 399 Length adjustment: 31 Effective length of query: 360 Effective length of database: 368 Effective search space: 132480 Effective search space used: 132480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS03230 BPHYT_RS03230 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.2807.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-143 463.5 3.1 2.9e-143 463.4 3.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS03230 BPHYT_RS03230 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS03230 BPHYT_RS03230 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 463.4 3.1 2.9e-143 2.9e-143 1 385 [] 10 397 .. 10 397 .. 0.97 Alignments for each domain: == domain 1 score: 463.4 bits; conditional E-value: 2.9e-143 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaala 67 iv+a Rtpig + +g +k++++++Ll+++ik++++++ gld + i+++i+G++++++eq n+aR+ al lcl|FitnessBrowser__BFirm:BPHYT_RS03230 10 IVAASRTPIGkAPRGMFKNTRPDELLVHAIKSAVAQVpGLDTKVIEDAIIGCAIPEAEQgLNVARMGALL 79 8*********988********************************************************* PP TIGR01930 68 aglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakle 137 aglp+sv ++tvnr+CaSgl+A+a+aa++i++Ge d+++aGG+EsmS vp++ ++ s++++ ++++ lcl|FitnessBrowser__BFirm:BPHYT_RS03230 80 AGLPNSVGGVTVNRFCASGLTALAMAADRIRVGESDAMIAGGCESMSMVPMMGNKP----SMSPHIFDRN 145 **************************************************987775....7888888887 PP TIGR01930 138 dqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk...... 201 + d v ++ mg tAe++a++++isRe qD+++++Sh++a +A+++g+f+dei +++ ++ lcl|FitnessBrowser__BFirm:BPHYT_RS03230 146 E----D-VGIAYGMGLTAEKVAERWKISREAQDAFSVESHRRAIAAQQAGEFNDEIAAYTITERfpdlat 210 7....2.44689**************************************************99****** PP TIGR01930 202 ......kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltp 265 ++ vs Deg+r++t+le LakL+++f++ kgs vtAgNssq++DGA+al+++se+++ke++ltp lcl|FitnessBrowser__BFirm:BPHYT_RS03230 211 gevrvkTREVSLDEGPRAETSLEGLAKLRAVFAN-KGS-VTAGNSSQTSDGAGALIVVSEKMLKEFNLTP 278 ****998999**********************95.8*7.******************************* PP TIGR01930 266 larivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvn 335 lar+vs+av gv+pe+mg+gp +Ai++aLk agl+i+d+d++E+nEAFAaq lav+++lg ld++k+N lcl|FitnessBrowser__BFirm:BPHYT_RS03230 279 LARFVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKIDDLDWIELNEAFAAQSLAVIQDLG-LDPAKINPL 347 ************************************************************.99******* PP TIGR01930 336 GGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 GGAiAlGHPlGa+Ga+ t+++ L++r+ kyG++t+Cvg+G+GaA i+e lcl|FitnessBrowser__BFirm:BPHYT_RS03230 348 GGAIALGHPLGATGAIRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIE 397 ***********************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory