GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Burkholderia phytofirmans PsJN

Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate BPHYT_RS03230 BPHYT_RS03230 acetyl-CoA acetyltransferase

Query= SwissProt::O32177
         (391 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS03230 BPHYT_RS03230 acetyl-CoA
           acetyltransferase
          Length = 399

 Score =  358 bits (920), Expect = e-103
 Identities = 195/395 (49%), Positives = 268/395 (67%), Gaps = 8/395 (2%)

Query: 1   MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59
           +++A IV+ +RTP+GKA +G     RPD+L    +K  + +  G +   I+D IIGCA P
Sbjct: 5   LQDAYIVAASRTPIGKAPRGMFKNTRPDELLVHAIKSAVAQVPGLDTKVIEDAIIGCAIP 64

Query: 60  EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119
           EAEQGLN+AR    LAGLP +V  +TVNR+C+SGL ++A AA++I +G  D  IAGG ES
Sbjct: 65  EAEQGLNVARMGALLAGLPNSVGGVTVNRFCASGLTALAMAADRIRVGESDAMIAGGCES 124

Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMS--MGHTAEQVAKKYGVSREDQDAFAVRSHQNAA 177
           MS VPMMG+    +  + ++  +  ++  MG TAE+VA+++ +SRE QDAF+V SH+ A 
Sbjct: 125 MSMVPMMGNKPSMSPHIFDRNEDVGIAYGMGLTAEKVAERWKISREAQDAFSVESHRRAI 184

Query: 178 KALAEGKFKDEIVPVEVTVTEIGEDHKPME---KQFVFSQDEGVRPQTTADILSTLRPAF 234
            A   G+F DEI     T+TE   D    E   K    S DEG R +T+ + L+ LR  F
Sbjct: 185 AAQQAGEFNDEIAAY--TITERFPDLATGEVRVKTREVSLDEGPRAETSLEGLAKLRAVF 242

Query: 235 SVDGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEA 294
           +  G+VTAGNSSQTSDGA A++++  +      L PL +F SFAV GVPPE+MGIGP EA
Sbjct: 243 ANKGSVTAGNSSQTSDGAGALIVVSEKMLKEFNLTPLARFVSFAVRGVPPEIMGIGPKEA 302

Query: 295 IPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGT 354
           IP ALK AGL++ D+   ELNEAFA+Q++ VI++LG+D  K+N  GGAIALGHPLG TG 
Sbjct: 303 IPAALKAAGLKIDDLDWIELNEAFAAQSLAVIQDLGLDPAKINPLGGAIALGHPLGATGA 362

Query: 355 KLTLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389
               +++H ++RRN ++G+VTMC+G GMGAAG+ E
Sbjct: 363 IRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIE 397


Lambda     K      H
   0.316    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 434
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 391
Length of database: 399
Length adjustment: 31
Effective length of query: 360
Effective length of database: 368
Effective search space:   132480
Effective search space used:   132480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate BPHYT_RS03230 BPHYT_RS03230 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01930.hmm
# target sequence database:        /tmp/gapView.20901.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01930  [M=385]
Accession:   TIGR01930
Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
   2.6e-143  463.5   3.1   2.9e-143  463.4   3.1    1.0  1  lcl|FitnessBrowser__BFirm:BPHYT_RS03230  BPHYT_RS03230 acetyl-CoA acetylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS03230  BPHYT_RS03230 acetyl-CoA acetyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  463.4   3.1  2.9e-143  2.9e-143       1     385 []      10     397 ..      10     397 .. 0.97

  Alignments for each domain:
  == domain 1  score: 463.4 bits;  conditional E-value: 2.9e-143
                                TIGR01930   1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaala 67 
                                              iv+a Rtpig + +g +k++++++Ll+++ik++++++ gld + i+++i+G++++++eq  n+aR+ al 
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230  10 IVAASRTPIGkAPRGMFKNTRPDELLVHAIKSAVAQVpGLDTKVIEDAIIGCAIPEAEQgLNVARMGALL 79 
                                              8*********988********************************************************* PP

                                TIGR01930  68 aglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakle 137
                                              aglp+sv ++tvnr+CaSgl+A+a+aa++i++Ge d+++aGG+EsmS vp++ ++     s++++ ++++
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230  80 AGLPNSVGGVTVNRFCASGLTALAMAADRIRVGESDAMIAGGCESMSMVPMMGNKP----SMSPHIFDRN 145
                                              **************************************************987775....7888888887 PP

                                TIGR01930 138 dqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk...... 201
                                              +    d v  ++ mg tAe++a++++isRe qD+++++Sh++a +A+++g+f+dei  +++ ++      
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230 146 E----D-VGIAYGMGLTAEKVAERWKISREAQDAFSVESHRRAIAAQQAGEFNDEIAAYTITERfpdlat 210
                                              7....2.44689**************************************************99****** PP

                                TIGR01930 202 ......kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltp 265
                                                    ++ vs Deg+r++t+le LakL+++f++ kgs vtAgNssq++DGA+al+++se+++ke++ltp
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230 211 gevrvkTREVSLDEGPRAETSLEGLAKLRAVFAN-KGS-VTAGNSSQTSDGAGALIVVSEKMLKEFNLTP 278
                                              ****998999**********************95.8*7.******************************* PP

                                TIGR01930 266 larivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvn 335
                                              lar+vs+av gv+pe+mg+gp +Ai++aLk agl+i+d+d++E+nEAFAaq lav+++lg ld++k+N  
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230 279 LARFVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKIDDLDWIELNEAFAAQSLAVIQDLG-LDPAKINPL 347
                                              ************************************************************.99******* PP

                                TIGR01930 336 GGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385
                                              GGAiAlGHPlGa+Ga+   t+++ L++r+ kyG++t+Cvg+G+GaA i+e
  lcl|FitnessBrowser__BFirm:BPHYT_RS03230 348 GGAIALGHPLGATGAIRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIE 397
                                              ***********************************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (399 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.22
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory