Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate BPHYT_RS10815 BPHYT_RS10815 crotonase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__BFirm:BPHYT_RS10815 Length = 268 Score = 149 bits (375), Expect = 8e-41 Identities = 88/246 (35%), Positives = 134/246 (54%), Gaps = 13/246 (5%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQFNQLTPA 76 I L+RP LN ++ ++L A + DP +RVI++ KG+ F +G DI F + +P Sbjct: 31 IILHRPP-LNVISMHARDQLRAAFEALDDDPRVRVIVVRAKGEHFSSGGDIKGFLEASPE 89 Query: 77 E----AWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLP 132 AW + R SKP IA G+ G G EL+LACD RIA + LP Sbjct: 90 TVSKLAWNIAAPAR--------CSKPVIAANRGFCFGVGFELSLACDFRIATDTTFYALP 141 Query: 133 EINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETR 192 E LG PG GG+ RL +++G GR +++M RIPGK A ++G+ V + LE T Sbjct: 142 EQKLGQIPGSGGSARLQQMVGIGRTKDIVMRSRRIPGKQAYEWGIAVECVADSELEAATD 201 Query: 193 KLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKR 252 L +++ SP++ K+++N D+PL + LE + + +++D +EGV AF KR Sbjct: 202 ALVDELRAFSPLAQRTAKKLLNDTEDAPLSIAIELEGHCYSRLRASDDFREGVEAFHGKR 261 Query: 253 EPTFKG 258 +P F+G Sbjct: 262 KPVFRG 267 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 268 Length adjustment: 25 Effective length of query: 234 Effective length of database: 243 Effective search space: 56862 Effective search space used: 56862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory