Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate BPHYT_RS30440 BPHYT_RS30440 short-chain dehydrogenase
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__BFirm:BPHYT_RS30440 Length = 254 Score = 112 bits (281), Expect = 6e-30 Identities = 81/247 (32%), Positives = 132/247 (53%), Gaps = 14/247 (5%) Query: 9 IVSGAAS--GLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADISDEQAA 66 ++SG AS G+G ATA+ GA++ + DL+ +A A +G R V +++D A Sbjct: 13 VISGGASPRGIGMATARKFAAHGARIAIFDLDEKAAVEAAASIGPEHRGYVCNVTDRGAC 72 Query: 67 QSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFNLLRLAA 126 Q+AV+ V+ FGS+ L+N AGI A K L S+ ++++VNL G +L L+ Sbjct: 73 QAAVERTVADFGSIDILINNAGITQAAKFLDIDP----ESWDRILDVNLRG---VLYLSQ 125 Query: 127 AAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARFGIRV 186 A + + +SG G +++ S G +G Y+A+K + L AREL GIRV Sbjct: 126 AVVPQMKKQKSGSIG-CMSSVSAQRGGGILGGPHYSAAKAGVLGLAKAMARELGNDGIRV 184 Query: 187 MTIAPGIFETPMMAG-MSDEVRASLAAGVPFPPRLGRPQEYAALARHIIE--NSMLNGEV 243 + PG+ +T + AG +SD+ R + +G+P RLG P + A + +S + G V Sbjct: 185 NCVTPGLIQTDINAGKISDDKRVEILSGIPL-NRLGVPDDVAGAFLFLASDLSSYITGAV 243 Query: 244 IRLDGAL 250 I ++G + Sbjct: 244 IDVNGGM 250 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 254 Length adjustment: 24 Effective length of query: 231 Effective length of database: 230 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory