Align Propionyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.3) (characterized)
to candidate BPHYT_RS25975 BPHYT_RS25975 urea carboxylase
Query= reanno::PS:Dsui_0516 (663 letters) >FitnessBrowser__BFirm:BPHYT_RS25975 Length = 1203 Score = 390 bits (1001), Expect = e-112 Identities = 214/445 (48%), Positives = 289/445 (64%), Gaps = 5/445 (1%) Query: 2 FKKILIANRGEIACRVIKTARKMGIKTVAVYSEADKDALFVEMADEAVCIGPAASKESYL 61 F+K+LIANRGEIACRVI+T +++GI +VAVYSEAD+ A+ V +ADEAVCIGPA + +SYL Sbjct: 3 FRKVLIANRGEIACRVIRTLKRLGIASVAVYSEADRHAMHVMLADEAVCIGPALAAQSYL 62 Query: 62 VADKIIAACKQTGAEAVHPGYGFLSENAEFSRRLEEEGIKFIGPKHYSIAKMGDKIESKK 121 + I+ A + GA+AVHPGYGFLSENA F++ ++ GI+FIGP + + G K +++ Sbjct: 63 NSAAILDAARACGADAVHPGYGFLSENAAFAQACDDAGIRFIGPTPQHMREFGLKHTARE 122 Query: 122 LAIEAKVNTIPGYNDAIDGPDAAVEIAKKIGYPVMIKASAGGGGKGLRVAYNDAEAHEGF 181 LA V +PG + AA+ A+ IGYPVM+K++AGGGG G+ + + A+ F Sbjct: 123 LAQANDVALLPG-TGLLPDVSAALREAESIGYPVMLKSTAGGGGIGMSLCRDAAQLEGVF 181 Query: 182 SSCVNEARNSFGDDRVFIEKYVLEPRHIEIQVLGDSHGNYVYLNERDCSIQRRHQKVIEE 241 +S +F + V++EK+V RHIE+QV GD G + L ERDCS+QRR+QKVIEE Sbjct: 182 ASVARLGEANFANAGVYVEKFVENARHIEVQVFGDGKGGVISLGERDCSVQRRNQKVIEE 241 Query: 242 APSPFVDPEMRKAMGEQAVALARAVNYESAGTVEFVVSGATKEFYFLEMNTRLQVEHPVT 301 P+P + R A+ AV LA+AV Y+SAGTVEFV T+ FYFLE+NTRLQVEH VT Sbjct: 242 TPAPGLTHAERSALHASAVRLAQAVKYKSAGTVEFVFDADTRRFYFLEVNTRLQVEHCVT 301 Query: 302 ELITGLDLVEQMIRVAYGEKLPLTQADVQINGWAMECRINAEDPFRGFLPSTGRLVKFQP 361 E ITG+DLVE MIR A GE PL G +++ R+ AEDP + F PS G L Sbjct: 302 EEITGIDLVEWMIREAEGELAPLDTLATVPQGASIQVRLYAEDPHKQFQPSAGVLTHVAF 361 Query: 362 PAEVDGQVRVDTGVYDGGEISMYYDSMIAKLIVHGASREQAIARMRDALNGFVIRGISSN 421 A+ RVDT V G E+S +YD ++AKLIV G +RE +A +R AL + GI +N Sbjct: 362 AAD----ARVDTWVDSGTEVSAFYDPLLAKLIVKGETREAGLAALRAALEQTQLYGIETN 417 Query: 422 IPFQAALMQHARFQSGIFDTGFIAK 446 + + A+ A F G T F+ + Sbjct: 418 LDYLRAIAGSATFARGEQTTAFLGR 442 Score = 31.2 bits (69), Expect = 3e-04 Identities = 15/57 (26%), Positives = 34/57 (59%) Query: 597 LLSPMPGLLREVSVAVGQEVKAGEKLAVIEAMKMENILKAEQDCKVKKISVTAGSSL 653 +++ + G + ++ V G+ V G+ +A++E+MKME + A D ++ I G+++ Sbjct: 1123 IVADVSGSVWKLLVKEGERVGDGQVVAIVESMKMEISVTASGDGVIETIDCAEGAAV 1179 Lambda K H 0.319 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1746 Number of extensions: 82 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 663 Length of database: 1203 Length adjustment: 43 Effective length of query: 620 Effective length of database: 1160 Effective search space: 719200 Effective search space used: 719200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory