Align D-gluconate dehydrogenase cytochrome c subunit (EC 1.1.99.3) (characterized)
to candidate BPHYT_RS01060 BPHYT_RS01060 alcohol dehydrogenase
Query= metacyc::MONOMER-12746 (434 letters) >FitnessBrowser__BFirm:BPHYT_RS01060 Length = 417 Score = 452 bits (1163), Expect = e-132 Identities = 227/407 (55%), Positives = 282/407 (69%), Gaps = 13/407 (3%) Query: 21 EADQQALVQQGEYLARAGDCVACHTAKDGKPFAGGLPMETPIGVIYSTNITPDK-TGIGD 79 +A+ AL+++G YLA GDC ACH AKDGK F GGLP+ TPIG +Y+TNITPD TGIG+ Sbjct: 1 DANDTALIRRGAYLAVLGDCAACHVAKDGKAFVGGLPITTPIGTLYTTNITPDPATGIGN 60 Query: 80 YSFEDFDKAVRHGVAKGGSTLYPAMPFPSYARVSDADMQALYAYFMKGVAPVARDNQDSD 139 Y+ DF++AVR G+ + GS +YPAMP+PSYA VSD D++ALYAYFM GVAPV N+ S Sbjct: 61 YTPSDFERAVRRGIRRDGSPMYPAMPYPSYAHVSDDDVRALYAYFMHGVAPVDSPNRASG 120 Query: 140 IPWPLSMRWPLSIWRWMFAPSVE----------TPAPAAGSDPVISRGAYLVEGLGHCGA 189 IPWPLSMRWPL+ WRW FAP V+ T A AA ++ RG YLVEGL HCG+ Sbjct: 121 IPWPLSMRWPLTYWRWAFAPKVQPAAHTDIDSATAAGAAHDAALLERGRYLVEGLMHCGS 180 Query: 190 CHTPRALTMQEKALSASGGSDFLSGSAPLEGWIAKSLRGDHKDGLGSWSEEQLVQFLKTG 249 CHTPR + +QEKAL + GSD+LSG ++ ++A SLRGD GLG WS+ +V+FL+TG Sbjct: 181 CHTPRGVGLQEKALGDADGSDYLSGGV-IDHYVANSLRGDDLTGLGRWSQADIVEFLRTG 239 Query: 250 RSDRSAVFGGMSDVVVHSMQYMTDADLTAIARYLKSLPANDPKDQPHQYDKQVAQALWNG 309 R+ +A FGGM DVV HS Q++ D DL A+A YLKSLP N P + Y AL G Sbjct: 240 RNPETAAFGGMRDVVQHSSQFLNDTDLLAVATYLKSLPGNHPAGH-YAYAAAAGAALAKG 298 Query: 310 DDSKPGAAVYIDNCAACHRTDGHGYTRVFPALAGNPVLQSADATSLIHIVLKGGTLPATH 369 D S GA Y+++CAACH + G GY FPALAGNPV+ + D TSLI+IVL G T T Sbjct: 299 DVSARGAIDYLNSCAACHLSSGKGYRDTFPALAGNPVVNAKDPTSLINIVLNGNTEVGTS 358 Query: 370 SAPSTFTMPAFAWRLSDQEVADVVNFIRSSWGNQASAVKPGDVAALR 416 P+ FTMP F RL+D EVA+VV FIR+SWGN A V +VA +R Sbjct: 359 RVPTQFTMPPFGDRLTDAEVANVVTFIRTSWGNHAPDVNADEVAKVR 405 Lambda K H 0.316 0.131 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 633 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 417 Length adjustment: 32 Effective length of query: 402 Effective length of database: 385 Effective search space: 154770 Effective search space used: 154770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory