Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate BPHYT_RS04375 BPHYT_RS04375 epimerase
Query= curated2:Q56623 (328 letters) >FitnessBrowser__BFirm:BPHYT_RS04375 Length = 318 Score = 209 bits (532), Expect = 7e-59 Identities = 126/314 (40%), Positives = 181/314 (57%), Gaps = 12/314 (3%) Query: 12 ILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVGDINASTDFE------ 65 +L+TG+ GFVG L ++L + V VR + ++ G+ V + S DF Sbjct: 4 VLVTGANGFVGRALCRALR-DAGNTVTGLVRRQMPREYGVDEWV---DPSVDFAGMDAGW 59 Query: 66 LPLKNTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIK 125 VVH AAR HVM + A+P ++ N GT+ A+ A GV+RF+F+SSIK Sbjct: 60 PEALQVDCVVHLAARVHVMLEDAADPEAAFQATNVEGTLRCARAAWRHGVRRFVFVSSIK 119 Query: 126 VNGEGTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVK 185 E G P + +D+ AP+D YG SK AE+ L+ L + +E+VI+RP +VYGP V+ Sbjct: 120 AMTEADS-GRPVREDDSPAPQDPYGRSKRAAEEALIRLGAQTGLEIVIVRPPLVYGPDVR 178 Query: 186 ANFASLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDV 245 ANF SLM V KG+PLP G++ +RSLV ++NL D +V C +AA Q F V+D + Sbjct: 179 ANFLSLMNAVWKGVPLPLGALGA-RRSLVYVDNLADALVHCATDARAAQQCFHVADSDAL 237 Query: 246 STAEMVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGW 305 + AE+ R L L +P LPVP +L G+L G++ VDRL G+LQ+D S + LGW Sbjct: 238 TIAELARALGRHLGRPARLLPVPESWLRLAGRLTGRTAQVDRLVGSLQLDTSRIRTVLGW 297 Query: 306 KPPQTLQEGFKQTA 319 + P + +EG TA Sbjct: 298 QAPYSTEEGLAATA 311 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 318 Length adjustment: 28 Effective length of query: 300 Effective length of database: 290 Effective search space: 87000 Effective search space used: 87000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory