Align galactaro-1,5-lactonase (characterized)
to candidate BPHYT_RS24170 BPHYT_RS24170 gluconolactonase
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__BFirm:BPHYT_RS24170 Length = 309 Score = 318 bits (814), Expect = 1e-91 Identities = 161/285 (56%), Positives = 191/285 (67%), Gaps = 7/285 (2%) Query: 12 AVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIARTDAGNWVAGME 71 AVGE PVW E ALYWVDIP + R +G + W P+ +ACIA G +AG E Sbjct: 21 AVGESPVWRAAEQALYWVDIPAQKIVRLRIDSGERSEWLLPEKVACIAFDHRGTVLAGCE 80 Query: 72 TGFFQLT----PHNDGSLDTT--LLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVLNMGLN 125 TG F LT N ++ T LAA + DMR NDGRCDRQGRFWAG+MV +M Sbjct: 81 TGLFALTLTESAANGEAVQVTGRKLAAPDFACDDMRFNDGRCDRQGRFWAGTMVQDMAAA 140 Query: 126 AAEGTLYRYTS-GAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDYDIDTG 184 G LYR+ G ++ IT NGLA+SPDG TMY SDSHPL +QIWAFDYDI++G Sbjct: 141 KPAGALYRFDERGMLSAPVVEELITQNGLAWSPDGATMYLSDSHPLRRQIWAFDYDIESG 200 Query: 185 TPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTVPVKKPT 244 P NRRVF D+++H GRPDGAAVDADGCYWICANDAGL+ RF+P+G+LDR + VP KP Sbjct: 201 EPRNRRVFADLNQHAGRPDGAAVDADGCYWICANDAGLLLRFTPEGKLDRQIAVPAIKPA 260 Query: 245 MCAFGGSRLDTLFVTSIRDDQSEQSLSGGVFALNPGVVGLPEPTF 289 MCAFGG LDTLFVTSIR + G +FA+ PG+ GLPEP F Sbjct: 261 MCAFGGRELDTLFVTSIRPAANASEHDGHLFAVRPGITGLPEPEF 305 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 309 Length adjustment: 27 Effective length of query: 264 Effective length of database: 282 Effective search space: 74448 Effective search space used: 74448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory