Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BPHYT_RS04180 BPHYT_RS04180 sugar ABC transporter substrate-binding protein
Query= uniprot:A0A165KPY4 (416 letters) >FitnessBrowser__BFirm:BPHYT_RS04180 Length = 415 Score = 410 bits (1055), Expect = e-119 Identities = 218/411 (53%), Positives = 274/411 (66%), Gaps = 6/411 (1%) Query: 7 IAAVAVGLAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKGHTWRDFAVAGGGGDS 66 I A + +A ++++A + VLH+WTSGGE+K++ LK M +G+ W+DFAVAGG G + Sbjct: 10 IVASTLATSAQVASAAESLSVLHWWTSGGESKAIRVLKDDMDKQGYEWKDFAVAGGAGAA 69 Query: 67 AMTVLKSRVISGNPPSAAQTKGPAIQEWASEGVLANMDTLAKAEKWDELLPKVVADVMKY 126 AMT LK++V+SGN PSAAQ KGP IQ+WA +GVL ++D A W LP + M Sbjct: 70 AMTALKTQVMSGNAPSAAQIKGPLIQDWADQGVLVDIDK--SATDWKAQLPAQINKTMMS 127 Query: 127 KGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVPVAHGGQN 186 KG YVAAP +VHR+NW+W + AL K G P TW EFFA ADK +AAG+ PVA GGQ Sbjct: 128 KGHYVAAPFSVHRINWLWINKAALDKVG-GKPPTTWPEFFALADKFRAAGITPVARGGQP 186 Query: 187 WQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDPGAPGRDW 246 WQD T +E+VVL G A FY+ A++ LD LTS M + +T R+I+GY D G+ GRDW Sbjct: 187 WQDMTIWETVVLSQG-ADFYRKAMIDLDQKTLTSPQMLQVFQTARKIQGYFDKGSTGRDW 245 Query: 247 NLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVDSFILFKL 306 NLATAM+I G G Q MGDWAKGEF A K D++CAAAPG++NAFT+ VDSF+ F+ Sbjct: 246 NLATAMVINGSGGMQFMGDWAKGEFANANKKADVDYICAAAPGTSNAFTYTVDSFVFFQQ 305 Query: 307 K-DAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKDFVDTAK 365 A Q LA +IMSPAFQE F+L KGSIPVR MDKFD CAK S D T K Sbjct: 306 NGKKEATLGQLALAKTIMSPAFQEQFSLYKGSIPVRQDVSMDKFDACAKKSYADEQTTIK 365 Query: 366 SGGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKKIAAAAKTK 416 S PS A G + ATEGAI DVV+ F N ++ +AM+K+AAAAK K Sbjct: 366 SNTFFPSFAFGDVQSSATEGAITDVVTGFMNSNE-DPQEAMRKVAAAAKVK 415 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 415 Length adjustment: 31 Effective length of query: 385 Effective length of database: 384 Effective search space: 147840 Effective search space used: 147840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory