Align KguT (characterized, see rationale)
to candidate BPHYT_RS30610 BPHYT_RS30610 major facilitator transporter
Query= uniprot:A0A167V864 (425 letters) >FitnessBrowser__BFirm:BPHYT_RS30610 Length = 429 Score = 230 bits (586), Expect = 7e-65 Identities = 137/404 (33%), Positives = 205/404 (50%), Gaps = 16/404 (3%) Query: 12 WYIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLGYFFFQVPGAI 71 W ++P + Y AYLDR N GFA M DL + A + +FF+GY F++P + Sbjct: 22 WRLLPFLVTCYMFAYLDRVNVGFAKLQ-MQTDLGFSDAAYGVGAGIFFIGYVLFELPSNL 80 Query: 72 YAEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMPAMLIYLCHWF 131 K ++ L+LWG + V+SV A+RFLLGV EA P M+ YL W+ Sbjct: 81 MLPKVGARRTFSRILVLWGITSACMLFVRSVPAFYAMRFLLGVFEAGFAPGMIYYLSCWY 140 Query: 132 TRAERSRANTFL--------ILGNPVTILWMSVVSGYLVKHFDWRWMFIIEGLPAVLWAF 183 A +RA + I+G PV+ M+ +SG + W+WMF++EGLP + Sbjct: 141 GPARMARAIALVFVAGPLGGIVGGPVSAWLMTSLSG-VGGLAGWQWMFLVEGLPCIALGL 199 Query: 184 IWWRLVDDRPEQASWLKAQEKTAL-REALAAEQQGIKPVKNYREAFRSPKVIILSLQYFC 242 + R++ DRPEQA WL EK L RE E + +++ +SP+V +L+ YF Sbjct: 200 LTLRVLSDRPEQARWLNDDEKLLLGRETAPTEHR----ADSFKAVLKSPRVYVLAFAYFS 255 Query: 243 WSIGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRMQKRKRFVW 302 +Y WLP++LK+ D + GW SA+PY+ A + M +SDR+ +R+ Sbjct: 256 IIFPIYAISFWLPTLLKEQGVSDTIRLGWYSAIPYVVAAVCMYLAGRSSDRVGERRYHCA 315 Query: 303 PPLLIAALAFYGSYILGTEHFWWSYTLLVIAGACMYAPYGPFFAIVPELLPSNVAGGAMA 362 P L AA+ + I + + T L + AC++ Y F+AI +L+ A G +A Sbjct: 316 IPALGAAICLIAA-IFADGNVMLTLTALTLGTACLWMAYTVFWAIPSQLVEGTAAAGGIA 374 Query: 363 LINSMGALGSFSGSWLVGYLNGVTGGPGASYLFMCGALLVAVAL 406 LIN++G G F GS +VG+ TG A M GA +A L Sbjct: 375 LINTVGLSGGFWGSAVVGWAKASTGSMHAGLFVMAGAAALAAIL 418 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 606 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 429 Length adjustment: 32 Effective length of query: 393 Effective length of database: 397 Effective search space: 156021 Effective search space used: 156021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory