Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BPHYT_RS31940 BPHYT_RS31940 ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__BFirm:BPHYT_RS31940 Length = 294 Score = 141 bits (356), Expect = 2e-38 Identities = 90/299 (30%), Positives = 152/299 (50%), Gaps = 15/299 (5%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 M VQ LN L GS+Y L A+G T+++G++G++NFAHG F LG ++ L Sbjct: 1 MALIVQLALNTLQAGSVYVLFALGLTLIFGVMGVVNFAHGQFFTLGALLTSVLVPALREA 60 Query: 61 FAGLPVAVLLL----VMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLS 116 F G+ VA+ + +V + + +L R R GSF I ++G+ + Sbjct: 61 F-GMGVALAFTFASAISIVAVLALAALVYQFGFRHYLRDTVGSF-----ILSVGLLLFFE 114 Query: 117 NFIQVTQGPRNKPIPPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQ 176 G + +P + + ++ L+++++ I ++ + + ++ T GRA Sbjct: 115 GVFLWVFGGVPRVVPNIAPGELRVFGAAIELQRLVVFAIAVIITVLLYLMLAFTRFGRAI 174 Query: 177 RATEQDRKMAALLGVNVDQTISITFVMGAALAAVAG--TMYLMYYGVASFNDGFTPGVKA 234 RAT D A L G+ +T+ F++G+ L+AV+G T + A ND +K Sbjct: 175 RATADDAGAATLQGIRDKRTLLYGFMVGSFLSAVSGCLTAPIAVITPAVGNDYL---IKG 231 Query: 235 FTAAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILG 293 F ++GG+GS+PGA+FGGL I LIES+ YF + F ++A +L+ +P G+LG Sbjct: 232 FITIIIGGLGSVPGAIFGGLTIALIESVVGYYFDGTMATIGMFCVVALLLLIRPQGMLG 290 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 294 Length adjustment: 26 Effective length of query: 274 Effective length of database: 268 Effective search space: 73432 Effective search space used: 73432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory