Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate BPHYT_RS19350 BPHYT_RS19350 amino acid ABC transporter substrate-binding protein
Query= TCDB::Q9L3M3 (381 letters) >FitnessBrowser__BFirm:BPHYT_RS19350 Length = 382 Score = 203 bits (516), Expect = 7e-57 Identities = 130/366 (35%), Positives = 189/366 (51%), Gaps = 12/366 (3%) Query: 2 KKSLLSAVALTAMLAFSGNAWA----DVLIAVAGPLTGPNAAFGAQLQKGAEQAAADINA 57 K L+ AL A ++ +G A A DV + AGP+TG A +G Q G A D+NA Sbjct: 4 KMKQLAGAALVAAMSLAGTANAQSTEDVKVGFAGPMTGAQAHYGKDFQNGITLAVEDMNA 63 Query: 58 AGG-INGEQIKIEL--GDDVSDPKQGISVANKFAADGVKFVIGHFNSGVSIPASEVYAEN 114 I G+Q++ L DD +DP+ G +VA K DG+K ++GHFNSG +IPAS +YA Sbjct: 64 TKPVIGGKQVRFVLDSADDQADPRTGTTVAQKLVDDGIKGMLGHFNSGTTIPASRIYANA 123 Query: 115 GILRNHPGRDEPDLHGTGLWNTFRTCGRDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQ 174 GI P+ G TFR D QQG++AG + KIA+V D+T YGQ Sbjct: 124 GIPEIAMAT-APEYTQQGFKTTFRMMTSDTQQGSVAGTFAVKTLGVKKIAIVDDRTAYGQ 182 Query: 175 GLADETKKAMNAAGVTEVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQ 234 GLAD+ +KA AAG V E N DF +++ K+K +IY+GG ++A +++Q Sbjct: 183 GLADQFEKAAKAAGGQIVDREYTNDKAVDFKSILTKLKSVQPDLIYYGGADSQAAPMVKQ 242 Query: 235 AADQGLKATLVSGDGIVSNELASIAGDAVAGTLNTFGPDPTAN-PANKELVEKFKAAGFN 293 G+KA L+ G+ + + IAGDA GT+ + P P K+ V K+K FN Sbjct: 243 MKALGIKAPLMGGEMVHTPTFIQIAGDAANGTVASLAGLPLEEMPGGKDYVAKYKKR-FN 301 Query: 294 P--EAYTLYSYAAMQTIAGAAKAAGSLDPEAVAKAMKEKGPFPTVLGDISFDEKGDPKIP 351 + Y+ Y+Y + A K A S DP + + ++++D KGD K Sbjct: 302 EDVQTYSPYAYDGAMAMFDAMKKANSTDPAKYLPVLAKTSMPAVTSANLAYDSKGDLKNG 361 Query: 352 GYIMYE 357 G +Y+ Sbjct: 362 GITLYK 367 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 382 Length adjustment: 30 Effective length of query: 351 Effective length of database: 352 Effective search space: 123552 Effective search space used: 123552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory