Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate BPHYT_RS31745 BPHYT_RS31745 ABC transporter ATP-binding protein
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__BFirm:BPHYT_RS31745 Length = 389 Score = 426 bits (1096), Expect = e-124 Identities = 216/342 (63%), Positives = 264/342 (77%), Gaps = 3/342 (0%) Query: 12 AVALLVLPLIL-QSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYL 70 A+ + LPL++ + GN VR+ D A+LYV+LALGLNIVVG+AGLLDLGY+AFYAVGAY Sbjct: 30 AIGVTALPLLIGAAAGNYGVRVLDFAMLYVMLALGLNIVVGFAGLLDLGYIAFYAVGAYT 89 Query: 71 FALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAI 130 AL+ SPHLA +F M+P+G H W V+PVA +LAA G LGAPTL+LRGDYLAI Sbjct: 90 AALLTSPHLAAHFEWIGHMWPSGFHAPYWFVMPVAMVLAAIAGICLGAPTLRLRGDYLAI 149 Query: 131 VTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLYY 190 VTLGFGEI+RIF+NNLD PVN+TNGP+G+ + V V G +L + GF +V +YY Sbjct: 150 VTLGFGEIVRIFMNNLDRPVNITNGPQGITGVAPVTVAGFNLSETHAFLGFQFTTVYMYY 209 Query: 191 YLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGV 250 Y+F++ ++ V +C RLQ SRIGRAW AIREDEIAAKAMGINTRN+KLLAF MGASFGG+ Sbjct: 210 YVFVLCSLLVVWVCTRLQHSRIGRAWAAIREDEIAAKAMGINTRNVKLLAFAMGASFGGL 269 Query: 251 SGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGP 310 SGAMF FQGFVSPESF+L ESV ++A VVLGG+GHIPGVI GAVLL+ LPE+LR P Sbjct: 270 SGAMFAGFQGFVSPESFTLWESVTVLACVVLGGMGHIPGVIFGAVLLAILPEILRSTMTP 329 Query: 311 LQAMTDGR--LDSAILRQLLIALAMIIIMLLRPRGLWPSPEH 350 LQ G +D+ ++RQLL LAM+IIML RP GLWP+P+H Sbjct: 330 LQNAIFGHVIVDTEVIRQLLYGLAMVIIMLRRPEGLWPAPKH 371 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 389 Length adjustment: 30 Effective length of query: 328 Effective length of database: 359 Effective search space: 117752 Effective search space used: 117752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory