Align D-lysine oxidase (EC 1.4.3.3) (characterized)
to candidate BPHYT_RS13575 BPHYT_RS13575 FAD-dependent oxidoreductase
Query= metacyc::G1G01-3833-MONOMER (414 letters) >FitnessBrowser__BFirm:BPHYT_RS13575 Length = 430 Score = 67.0 bits (162), Expect = 1e-15 Identities = 104/412 (25%), Positives = 154/412 (37%), Gaps = 78/412 (18%) Query: 7 VLGAGIVGVSTALHLQARGRQVILIDRDEPGSGTSHGNAGLIERSSVIPYAFPRQLSALL 66 ++GAG G+STALHL +G +V +ID +EPG G S N G VIP Sbjct: 38 IVGAGYTGLSTALHLAEQGLRVCVIDANEPGWGASGRNGG-----QVIP----------- 81 Query: 67 RYGLNRQPDVRYSLAHLPKAAPWLWRYWRQ--SAPGRLAGAAADMLPLVQRCVDEHDALI 124 GL PD + RY + +A ++AG AAD + L+ Sbjct: 82 --GLKYDPD------------ELIRRYGPRDGNALVQMAGGAADTV----------FDLV 117 Query: 125 AAAGLEGLVQAKGWIEVFRDPALFEQAKTDAKGLSRYGLRFEILECGQLQAREHQLDATV 184 A G+ GWI+ L + A G E+L+ Q+ R DA V Sbjct: 118 ARHGIRCDATRAGWIQPTHSHKLLKTLYARAGQWEARGAPVELLDRAQVSKR-LGTDAFV 176 Query: 185 VGGIHWLDPKTVN-NPGALTRGYAALFLQRGGQFVHGDARSL---RQANGQWRVESRRGP 240 G W+D + + P + RG A Q G +HG R+ R ANG WR+ + GP Sbjct: 177 GG---WVDRRAGSVQPLSYARGLARA-AQAAGAQIHGGTRAAGIERGANG-WRIRTAHGP 231 Query: 241 ITADEVVACLGPQSADLFSGLGYQIPLAIKRGYHMHYSTRDGAQLEHSICDTQGGYVLA- 299 + + V D GL ++ ++ +T+ + D G +LA Sbjct: 232 VIESKQVLLATNGYTD---GLWPRLAQSVIAANSFIVATK-------PLADDVGATILAG 281 Query: 300 --PMARGVRLTTGIEFDAAS-----------APGNQIQLGRCEALARKLFPALGDRLDDT 346 + RL DA P N E A+ +FP L + Sbjct: 282 GEVASDSRRLLLYFRKDADGRLLMGGRGPFREPRNAADWAHLERAAQLMFPQLRGTEYEF 341 Query: 347 PWLGRRPCLPDMRPVIGPAPRHPGLWFNFGHAHHGLTLGPVCGRLLAELLTG 398 W GR + P + + G+ G+ G+ + G+ LA L G Sbjct: 342 RWAGRIAITRNFLPHVHMPAK--GMTIALGYNGRGIAMATTLGKHLAAYLGG 391 Lambda K H 0.322 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 34 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 430 Length adjustment: 32 Effective length of query: 382 Effective length of database: 398 Effective search space: 152036 Effective search space used: 152036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory