Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate BPHYT_RS04760 BPHYT_RS04760 3-keto-5-aminohexanoate cleavage protein
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__BFirm:BPHYT_RS04760 Length = 310 Score = 160 bits (406), Expect = 2e-44 Identities = 107/300 (35%), Positives = 154/300 (51%), Gaps = 33/300 (11%) Query: 4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVRED-DGTPTQDKE 62 K+II+ A+ GA T + +P T +IA ++ A +AGA+I+HLH R DG PT E Sbjct: 5 KVIISCAVTGATHTPSMSEYLPVTPAQIAAQSIEAAEAGAAILHLHARNPADGKPTPSPE 64 Query: 63 RFRKCIEAIREKCPDVIIQPSTGGAVGMTDLERLQ-PTELHPEMATLDCGTCNFG----- 116 FR+ + AI E D +I +TGG+ MT +RL P PEM +L+ G+ NF Sbjct: 65 VFRQFVPAIVE-ATDAVINVTTGGSTRMTLADRLAYPRLAKPEMCSLNMGSMNFSIHPIA 123 Query: 117 ------------------GDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRY 158 D IF NT IK+ L E G + E E +D G + + Sbjct: 124 ARMQSWRYDWEKDYIEGMEDTIFRNTFKDIKSILLELGEAGTRFEFECYDVGHLYNLAHF 183 Query: 159 QKQGFIQKPMHFDFVLGVQ--MSASARDLVFMSESIP-----EGSTWTVAGVGRHQFQMA 211 QG I+ P V G+ + A ++ M + E +++ G GRHQ Sbjct: 184 VDQGLIKPPFFIQSVFGILGGLGADPENMTVMRSTADRLFGRENYQFSILGAGRHQMAFV 243 Query: 212 ALAIVMGGHVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLK 271 + +MGG+VRVG ED+VY+ KG+ A+SN + V ++ R+ +EL EIATP EARQ+L LK Sbjct: 244 TMGAIMGGNVRVGLEDSVYLSKGVKAESNAQQVRKIRRILEELSFEIATPAEARQMLGLK 303 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 310 Length adjustment: 26 Effective length of query: 246 Effective length of database: 284 Effective search space: 69864 Effective search space used: 69864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory