Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate BPHYT_RS22385 BPHYT_RS22385 hypothetical protein
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__BFirm:BPHYT_RS22385 Length = 309 Score = 187 bits (476), Expect = 2e-52 Identities = 114/295 (38%), Positives = 169/295 (57%), Gaps = 28/295 (9%) Query: 1 MMEKLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDD-GTPTQ 59 M ++I+T A+ GA T +PA+P T ++IA A A KAGA++ H HVR+ G ++ Sbjct: 1 MNHEVIVTCAVTGAGDTVGKHPAIPVTPKQIAEAAIEAAKAGATVAHCHVRDPKTGRGSR 60 Query: 60 DKERFRKCIEAIREKCPDVIIQPSTG----------------GAV-----GMTDLERLQP 98 D + +R+ ++ IR DVII + G GA G+T L ++ Sbjct: 61 DPQLYREVVDRIRSSGTDVIINLTAGMGGDLEIGPGEDPMRFGANTDLVGGLTRLAHVE- 119 Query: 99 TELHPEMATLDCGTCNFG-GDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIR 157 EL PE+ TLDCGT NFG GD I+V+T ++ + + E GVKPE+E+FD G + +A + Sbjct: 120 -ELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGARRIQELGVKPELEIFDTGHLWFAKQ 178 Query: 158 YQKQGFIQKPMHFDFVLGVQMSASARDLVF--MSESIPEGSTWTVAGVGRHQFQMAALAI 215 K+G + P F LG+ A A M++++P G+ W G+GR Q M A A+ Sbjct: 179 LLKEGLLDAPPLFQICLGIPWGAPADTTTMKAMADNLPPGAQWAGFGIGRMQMPMVAQAM 238 Query: 216 VMGGHVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSL 270 ++GGHVRVG EDN+++DKG+ A +NG LV+R V + + LG TP E R+ L L Sbjct: 239 LLGGHVRVGLEDNIWLDKGVPA-TNGTLVQRAVEIIERLGARALTPAEGRRKLGL 292 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 309 Length adjustment: 26 Effective length of query: 246 Effective length of database: 283 Effective search space: 69618 Effective search space used: 69618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory