Align 3-keto-5-aminohexanoate cleavage enzyme; EC 2.3.1.247 (characterized)
to candidate BPHYT_RS31475 BPHYT_RS31475 hypothetical protein
Query= SwissProt::B0VHH0 (276 letters) >FitnessBrowser__BFirm:BPHYT_RS31475 Length = 274 Score = 206 bits (525), Expect = 3e-58 Identities = 114/274 (41%), Positives = 163/274 (59%), Gaps = 2/274 (0%) Query: 2 EPLILTAAITGAETTRADQPNLPITPEEQAKEAKACFEAGARVIHLHIREDDGRPSQRLD 61 +P I++ AITG+ + D P +PIT EQ + +A FEAGA ++HLH+R DD P+ D Sbjct: 3 KPCIISVAITGSLPRKKDNPAVPITVNEQVESTQAAFEAGASLVHLHVRNDDETPTSNPD 62 Query: 62 RFQEAISAIREVVPEIIIQISTGGAVGESFDKRLAPLALKPEMATLNAGTLNFGDDIFIN 121 RF + IR+ P +I Q+STGG G ++R A L+L+P+MA+L G++NF ++ N Sbjct: 63 RFALVLEGIRKHAPGMITQVSTGGRSGAG-NERGAMLSLRPDMASLATGSVNFPTRVYDN 121 Query: 122 HPADIIRLAEAFKQYNVVPEVEVYESGMVDAVARLIKKGIITQNPLHIQFVLGVPGGMSG 181 P I LA K Y + PEVE ++ M+ A + G I PLHIQFV+G+ M Sbjct: 122 PPDLIDWLAAEMKAYGIKPEVEAFDLSMIFQAAAMQAAGAIV-GPLHIQFVMGIKNAMPV 180 Query: 182 KPKNLMYMMEHLKEEIPTATWAVAGIGRWHIPTSLIAMVTGGHIRCGFEDNIFYHKGVIA 241 + L + + LK P ATW AGIGR + + ++ GGH R G EDN+ K +A Sbjct: 181 DREVLEFYVRTLKRLSPDATWTGAGIGRNQLTMARWSLELGGHCRTGLEDNVRMDKNTLA 240 Query: 242 ESNAQLVARLARIAKEIGRPLATPEQAREILALN 275 SN+ LV ++A + +E GRP+AT QAREIL L+ Sbjct: 241 PSNSALVRQVAELCEEFGRPVATAAQAREILNLS 274 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 274 Length adjustment: 25 Effective length of query: 251 Effective length of database: 249 Effective search space: 62499 Effective search space used: 62499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory