Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate BPHYT_RS10155 BPHYT_RS10155 2,2-dialkylglycine decarboxylase
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__BFirm:BPHYT_RS10155 Length = 433 Score = 216 bits (550), Expect = 1e-60 Identities = 144/417 (34%), Positives = 218/417 (52%), Gaps = 18/417 (4%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P++IER +G VYD DG DF SG +GHSHP +V I + A K H + Sbjct: 26 PMIIERAQGSFVYDADGRAILDFTSGQMSAVLGHSHPEIVSVINEYAGKLDHL-FSGMLS 84 Query: 97 ENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQ 156 + LA +L E+ P ++R ++ ++GAE+NEAA+++ K TG+ + + F ++HG T Sbjct: 85 RPVVDLATRLAEITPDGLDRALLL-STGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTA 143 Query: 157 AVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVF 216 A S T S + G P G IP P YR + G + D L LD+ + + Sbjct: 144 AAASATYS--AGRKGVGPAAVGSFAIPAPFLYRPRFERHG--DYDYLAE--LDYAFDLID 197 Query: 217 RHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFW 276 R + + A EPI GG + P+G+ ALK+ +E G+LL DE Q G+GRTG + Sbjct: 198 RQSSGN-LAAFIAEPILSSGGIIELPEGYMTALKRKCEERGMLLILDEAQTGVGRTGTMF 256 Query: 277 AIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADI---TFDKPGRHATTFGGNPVAIAAGIE 333 A + GV PD++ K +G GLPLA V+ A I + TT +P+ A G+ Sbjct: 257 ACQRDGVTPDILTLSKTLGAGLPLAAVVTSAQIEERAHELGYLFYTTHVSDPLPAAVGLR 316 Query: 334 VVEIVKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYP 391 V+E+V+ L+ +G L + L + E+++ IGD RG GL +EIVK + TKE Sbjct: 317 VLEVVERDGLVARANLMGARLKRGLLDLMERFDCIGDIRGRGLLLGMEIVKDRRTKEPAD 376 Query: 392 ELRDRIVKESAKRGL----VLLGCGDNSIRFIPPLIVTKEEIDVAMEIFEEALKAAL 444 L +I +E GL V L R PPL V ++EID+ +++ +A++ +L Sbjct: 377 GLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVHEDEIDLGLDLLGQAIERSL 433 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 433 Length adjustment: 32 Effective length of query: 413 Effective length of database: 401 Effective search space: 165613 Effective search space used: 165613 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory