Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate BPHYT_RS27170 BPHYT_RS27170 hypothetical protein
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__BFirm:BPHYT_RS27170 Length = 442 Score = 191 bits (485), Expect = 4e-53 Identities = 117/355 (32%), Positives = 182/355 (51%), Gaps = 24/355 (6%) Query: 70 AGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPL-HSQELLDPLRAM 128 AG ++D+ G+ +ID GG + +GH N V+ A++ Q + P H+ Sbjct: 18 AGDGIEIIDSTGKRYIDASGGAAVSCLGHSNQRVIDAIKRQAQQLPYAHTSFFTTAPAEE 77 Query: 129 LAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKSL 185 LA L A P L++ +F + G+E++EAALKLA+ Y +G + FIA ++HG +L Sbjct: 78 LADRLVASAPQGLEHVYFVSGGSEAIEAALKLARQYFVEKGEPQRRHFIARRQSYHGNTL 137 Query: 186 GALSATAKSTFRKPFMPLLPGFRHVP----------------FGNIEAMRTALNECKKTG 229 GAL+ + R+PF+P+L HV F A + Sbjct: 138 GALAIGGNAWRREPFLPILIEAHHVSPCYAYREQRADETEEAFAQRLADELEQKILELGA 197 Query: 230 DDVAAVILEPIQGE-GGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEH 288 D VAA + E + G G + P Y +R +CD +G L+ILDE+ +GMGRTG ++ACE Sbjct: 198 DTVAAFVAETVVGATAGAVPPVREYFRKIRAVCDRYGVLLILDEIMSGMGRTGHLYACEE 257 Query: 289 ENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNP--FLHTTTFGGNPLACAAALAT 346 + V PDIL +AK LG G PIGAT+ ++ ++ + F H T+ G+ ACAAAL Sbjct: 258 DGVAPDILTIAKGLGAGYQPIGATLVSDRIYQAIVGGSGFFQHGHTYIGHATACAAALEV 317 Query: 347 INVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIG 401 V+ E L +G+ L R+ ++P + + RG+G+ + +E V + G Sbjct: 318 QRVIEEDKLLPNVLARGEQLRGQLREHYAQHPH-IGDVRGRGLFVGVELVRDRAG 371 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 442 Length adjustment: 33 Effective length of query: 426 Effective length of database: 409 Effective search space: 174234 Effective search space used: 174234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory