GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ydiJ in Burkholderia phytofirmans PsJN

Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate BPHYT_RS13750 BPHYT_RS13750 D-2-hydroxyacid dehydrogenase

Query= BRENDA::O23240
         (559 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13750 BPHYT_RS13750
           D-2-hydroxyacid dehydrogenase
          Length = 472

 Score =  303 bits (775), Expect = 1e-86
 Identities = 168/461 (36%), Positives = 260/461 (56%), Gaps = 12/461 (2%)

Query: 104 KEILGEKNVVEDKERLETANTDWMHKYKGSSKLMLLPKNTQEVSQILEYCDSRRLAVVPQ 163
           ++ +G   V+ D        TDW  +Y G++  +L P    EV+ +++     R+A+VPQ
Sbjct: 11  RDAIGAAQVLTDPHDTALYLTDWRRRYAGAACAVLCPATPDEVAALVKLAVEHRIALVPQ 70

Query: 164 GGNTGLVGGSVPVFD--EVIVNVGLMNKILSFDEVSGVLVCEAGCILENLATFLDTKGFI 221
           GGNTGL GG+ P     + ++++  +N++   D  +  +  EAG IL  +    D  G +
Sbjct: 71  GGNTGLAGGATPDASGAQAVISLRRLNRVRDIDPHNNTITVEAGVILAEVQKHADEAGRL 130

Query: 222 MPLDLGAKGSCHIGGNVSTNAGGLRLIRYGSLHGTVLGLEAVTANGNVLDMLGTLRKDNT 281
            PL L A+GSC IGGN++TNAGG  ++RYG+     LGLE VT  G + D L  LRKDNT
Sbjct: 131 FPLSLAAEGSCTIGGNLATNAGGTGVLRYGNARELCLGLEVVTPQGELWDGLRGLRKDNT 190

Query: 282 GYDLKHLFIGSEGSLGIVTKVSILTQPKLSSVNLAFIACKDYLSCQKLLVEAKRNLGEIL 341
           GYDL+ LFIG+EG+LGI+T   +   P+ ++   A  A     +    L   +R  G +L
Sbjct: 191 GYDLRDLFIGAEGTLGIITAAVLKLHPRPAARVTALAALASPHAALDFLSLTQRVAGPLL 250

Query: 342 SAFEFLDNNSMDLVLNHLDGVRNPVSSSENFYILIETTGSD-ETNDREKLEAFLLKSLEK 400
           + FE + +  + LV  H + +R P +      +L+E + S+ E + RE  E  +  +LE 
Sbjct: 251 TGFELMSDFCLRLVGRHFEQMRYPFAEPHAQVVLLELSDSESEEHARELFERLMETALES 310

Query: 401 GLVSDGVIAQDINQASSFWRIREGITEALQKAGAVYKYDLSLPVEEIYNIVNDLRGRLGD 460
           GLV D V+A++++Q+ +FW +RE I  A  + G   K+D+++P+  + + + +    +  
Sbjct: 311 GLVQDAVVAENLSQSRAFWNLREHIPLAQAEEGLNIKHDIAVPISRVGHFIEETDAAIAQ 370

Query: 461 L---ANVMGYGHLGDGNLHLNISAAEYNDKLLGL------IEPYVYEWTSKHRGSISAEH 511
               A ++ +GHLGDGNLH N+ A E  D    L      I   VY+   +HRGSISAEH
Sbjct: 371 AVPGARMVTFGHLGDGNLHYNVQAPEGVDAKAFLTQYQSPINQIVYDSVHRHRGSISAEH 430

Query: 512 GLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNPYKVL 552
           GLG +K +E  + K    V LM ++K+ LDP  ++NP KVL
Sbjct: 431 GLGQLKIDEAMHYKQDVEVQLMRAVKRALDPLNLMNPGKVL 471


Lambda     K      H
   0.317    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 592
Number of extensions: 20
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 559
Length of database: 472
Length adjustment: 35
Effective length of query: 524
Effective length of database: 437
Effective search space:   228988
Effective search space used:   228988
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory