GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mt2d in Burkholderia phytofirmans PsJN

Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate BPHYT_RS28510 BPHYT_RS28510 dioxygenase

Query= BRENDA::O08355
         (493 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS28510 BPHYT_RS28510 dioxygenase
          Length = 492

 Score =  352 bits (904), Expect = e-101
 Identities = 198/494 (40%), Positives = 277/494 (56%), Gaps = 16/494 (3%)

Query: 1   MKLNKQNLTQLAP----EVKLPAYTLADTRQGIAHIGVGGFHRAHQAYYTDALMNTGEGL 56
           M+L+   L  LA     +V +PAY  A    GI H+G+G FHRAHQA YT+  +  G+  
Sbjct: 1   MRLSNAALASLAARAAGKVVVPAYDRASLAPGIVHLGLGAFHRAHQALYTEHALRAGDHR 60

Query: 57  DWSICGVGLRSEDRKARDDLAGQDYLFTLYELGDTDDTEVRVIGSISDMLLAEDSAQALI 116
            W I GV LR  D    + L  QD+L+ +     T D+ ++VIG++   L+A  S  A++
Sbjct: 61  -WGIVGVSLRRADTS--EALTAQDHLYAVDVRDGTADS-LQVIGALIASLVAPQSPAAVL 116

Query: 117 DKLASPEIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQR 176
           D +  P   IVSLTITE GYC + ++G      P I HDL   ++P++  GF+  AL  R
Sbjct: 117 DAMTDPRCHIVSLTITEKGYCRNPASGALQFDHPDIAHDLRAAAAPRSAIGFVVRALALR 176

Query: 177 RAAGIPAFTVMSCDNLPHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAMVDRITPMT 236
           RAAG+  FTV+SCDNLP NG   R   LAFA   +  L DWI+   +FPN MVDRI P+T
Sbjct: 177 RAAGLGPFTVLSCDNLPSNGDTMRALTLAFARETDPALADWIELEAAFPNTMVDRIVPLT 236

Query: 237 STAHRLQLHDEHGIDDAWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKI 296
           + A RL++  + G DDAWPV+ EPF QWV+ED+F   RPAWE+ G     D  PYE+ K+
Sbjct: 237 TDADRLRVAKQLGADDAWPVITEPFSQWVIEDRFAGPRPAWERAGATLVGDARPYEQAKL 296

Query: 297 GLLNGSHLALTYLGFLKGYRFVHETMNDPLFVAYMRAYMDLDVTPNLAPVPGIDLTDYKQ 356
            +LNG+H AL YLG L GY  V + +  P  + ++ + +  +V P L+      L  Y+ 
Sbjct: 297 RMLNGAHSALAYLGSLIGYDTVDQAIGAPAVLNFVESMLRDEVEPTLSRPA---LATYRA 353

Query: 357 TLVDRFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKG 416
            L  RF N A+  +L+++ +DGS K P+  + ++   +  G  TER A  +A W  YL G
Sbjct: 354 ELFARFRNTALDHRLQQIATDGSQKLPQRWLESVRANLKSGAPTERLAFALAGWIAYLGG 413

Query: 417 VDENGVSYTIPDPRAEFCQGLV-----SDDALISQRLLAVEEIFGTAIPNSPEFVAAFER 471
            DE G +Y I DP A+     V     +D A   + L  +E IFG  +   P FVA   R
Sbjct: 414 HDETGRTYAIADPLADRLTEAVRATLHADAADAVRTLFEIEPIFGRDLCAHPRFVAQVAR 473

Query: 472 CYGSLRDNGVTTTL 485
              ++R  GV   +
Sbjct: 474 HLAAIRAQGVVKAM 487


Lambda     K      H
   0.321    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 625
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 493
Length of database: 492
Length adjustment: 34
Effective length of query: 459
Effective length of database: 458
Effective search space:   210222
Effective search space used:   210222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory