Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate BPHYT_RS30440 BPHYT_RS30440 short-chain dehydrogenase
Query= SwissProt::Q8NK50 (266 letters) >FitnessBrowser__BFirm:BPHYT_RS30440 Length = 254 Score = 140 bits (354), Expect = 2e-38 Identities = 95/257 (36%), Positives = 138/257 (53%), Gaps = 14/257 (5%) Query: 9 NRLLDLFSLKGKVVVVTGASGPRGMGIEAARGCAEMGADLAITYSSRKEGAEKNAEELTK 68 +RLLD GKV V++G + PRG+G+ AR A GA +AI + EK A E Sbjct: 4 SRLLD-----GKVAVISGGASPRGIGMATARKFAAHGARIAIF-----DLDEKAAVEAAA 53 Query: 69 EYGVKVKVYKVNQSDYNDVERFVNQVVSDFGKIDAFIANAGATANSGVVDGSASDWDHVI 128 G + + Y N +D + V + V+DFG ID I NAG T + +D WD ++ Sbjct: 54 SIGPEHRGYVCNVTDRGACQAAVERTVADFGSIDILINNAGITQAAKFLDIDPESWDRIL 113 Query: 129 QVDLSGTAYCAKAVGAHFKKQGHGSLVITASMSGHVANYPQEQTSYNVAKAGCIHLARSL 188 V+L G Y ++AV KKQ GS+ +S+S Y+ AKAG + LA+++ Sbjct: 114 DVNLRGVLYLSQAVVPQMKKQKSGSIGCMSSVSAQRGGGILGGPHYSAAKAGVLGLAKAM 173 Query: 189 ANE-WRDFARVNSISPGYIDTGLS--DFIDEKTQELWRSMIPMGRNGDAKELKGAYVYLV 245 A E D RVN ++PG I T ++ D+K E+ S IP+ R G ++ GA+++L Sbjct: 174 ARELGNDGIRVNCVTPGLIQTDINAGKISDDKRVEI-LSGIPLNRLGVPDDVAGAFLFLA 232 Query: 246 SDASSYTTGADIVIDGG 262 SD SSY TGA I ++GG Sbjct: 233 SDLSSYITGAVIDVNGG 249 Lambda K H 0.314 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 254 Length adjustment: 24 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory