Align ABC-type sugar transport system, periplasmic component protein (characterized, see rationale)
to candidate BPHYT_RS16065 BPHYT_RS16065 LacI family transcriptional regulator
Query= uniprot:D8IZC6 (316 letters) >FitnessBrowser__BFirm:BPHYT_RS16065 Length = 317 Score = 176 bits (445), Expect = 9e-49 Identities = 113/308 (36%), Positives = 174/308 (56%), Gaps = 9/308 (2%) Query: 3 KNTIAIACSTLLLAAAAQPAMAADKPLKSVGVTVGDLANPFFVAIAKGAESGAHKINPDA 62 ++T A+A L+ A PA A PLK +G+T +L NP+FV + K A I A Sbjct: 16 RSTAALATLAFGLSFIAAPAAQA-APLK-IGMTFQELNNPYFVTMQKALNDAAASIG--A 71 Query: 63 KVTVVSSKYDLNTQVGQIENFIANKVDLIVLNAADSKGVGPAVKKAQKAGIVVVAVDVAA 122 V V + +D++ QV +E+ + K+D++++N DS G+ AV A+KAG+VVVAVD A Sbjct: 72 TVVVTDAHHDVSKQVSDVEDMLQKKIDILLVNPTDSTGIQSAVTSAKKAGVVVVAVDANA 131 Query: 123 AG-ADVTVMSDNTMAGAESCKFLAEKLQGKGNVVIVNGPPVSAVMDRVTGCKAEFKKSPG 181 G D V S N AG +C++LA+ + G G V I++G PV +++RV GCKA K+PG Sbjct: 132 NGPVDSFVGSKNYDAGEMACEYLAKSIGGSGEVAILDGIPVVPILERVRGCKAALAKAPG 191 Query: 182 IKILSDNQNAGGSRDGGMTTMSNLLAAQPKIDAVFAINDPTAIGAELAIRQAKRSDIKWI 241 +K++ D QN R ++ N++ A P + VF++ND ++GA AI ++ DIK + Sbjct: 192 VKLV-DTQNGKQERATALSVTENMIQAHPNLKGVFSVNDGGSMGALSAI-ESSGKDIK-L 248 Query: 242 SGVDGAPDAERALKDSKSLFAASPAQDPYGMAAESVAIGYAVMNGRAPQQKVKLLPVKLI 301 + VDGAP+A A++ S F + AQ P ++ I A G A K + VK+I Sbjct: 249 TSVDGAPEAIAAIQKPNSKFVETSAQFPADQVRIALGIALAKKWG-ANVPKTIPVDVKMI 307 Query: 302 TRDNVADY 309 + N + Sbjct: 308 DKSNAKGF 315 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 317 Length adjustment: 27 Effective length of query: 289 Effective length of database: 290 Effective search space: 83810 Effective search space used: 83810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory