Align Fructose import permease protein FrcC (characterized)
to candidate BPHYT_RS16055 BPHYT_RS16055 sugar ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__BFirm:BPHYT_RS16055 Length = 335 Score = 174 bits (441), Expect = 3e-48 Identities = 111/315 (35%), Positives = 166/315 (52%), Gaps = 10/315 (3%) Query: 43 LHSSPAAVPLIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGI 102 L S P I L++ I V F S + +L+QV+I I+ T VILT GI Sbjct: 31 LKRSTLFYPFIGLLVVCIVM-VFASDSFLSGANIENVLRQVSINAIIAVGMTCVILTGGI 89 Query: 103 DLSVGAIMVLSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTL 162 DLSVG++M L+ + G ++ G+ VG G NG VA +PP IVTL Sbjct: 90 DLSVGSVMALAGTLAAGLMVA-GMNAVAALAIGIAVGLGFGAANGFFVAFAGMPPIIVTL 148 Query: 163 GMWQIVLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLW 222 I +Y+ I + FFG +G VV+M ++ + W Sbjct: 149 ATMGIARGLALIYTGG-----YPIDGLPDWVSFFGSGKILGVQA---PVVIMAVIYVIAW 200 Query: 223 YVLNRTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSP 282 +L R +GRYVYA+G + +A +L+GV V R+ + +YT++GL A A L R+ S P Sbjct: 201 VLLERMPFGRYVYAIGGNEQATRLSGVRVARVKLIVYTIAGLTSAFAAIVLTARLMSGQP 260 Query: 283 TAGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIG 342 AG +++I AVV+GG S+ GGRGSI+G L GAL++GV + GL ++G +P ++ G Sbjct: 261 NAGVGFELDAIAAVVMGGTSISGGRGSIIGTLIGALLLGVLNNGLNMVGVNPYVQNVIKG 320 Query: 343 LLIIIAVAIDQWIRK 357 +I++A+ I + RK Sbjct: 321 GIILLAIYISRDRRK 335 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 335 Length adjustment: 29 Effective length of query: 331 Effective length of database: 306 Effective search space: 101286 Effective search space used: 101286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory