Align Fructose import permease protein FrcC (characterized)
to candidate BPHYT_RS22740 BPHYT_RS22740 ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__BFirm:BPHYT_RS22740 Length = 328 Score = 263 bits (672), Expect = 5e-75 Identities = 137/303 (45%), Positives = 194/303 (64%), Gaps = 6/303 (1%) Query: 51 PLIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIM 110 PLI LVL+ F + +F S ++LILQQ +V ++ QTL++LT GIDLS G +M Sbjct: 26 PLIALVLAC-GFFISQSSRFLSFQNLSLILQQTMVVAVIAIGQTLIVLTGGIDLSCGMVM 84 Query: 111 VLSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLA 170 S+IM +F G PP L+++CG+G AL G +NG L+ R+KLP FIVTLG I A Sbjct: 85 AFGSIIMTKFAVTLGVPPVLAILCGVGASALFGALNGVLITRIKLPAFIVTLGTLNIAFA 144 Query: 171 SNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAW 230 +YS A+ +S + F G F++G A TYG V+ +L+ W+VL T Sbjct: 145 LTQIYS-----NAESVSNLPDAIMFLGNTFKLGPADVTYGTVLTLLMYLATWFVLRDTVP 199 Query: 231 GRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANI 290 GR++YA+G++PEAA+L G++ ++L+++Y+L+G I +A + R G P AGQ N+ Sbjct: 200 GRHLYALGNNPEAARLMGLSSQKILLTVYSLAGAIYGIAALLSVSRTGVGDPQAGQTENL 259 Query: 291 ESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVA 350 +SITAVV+GG SLFGGRGSI G L GALIVGVF GL L+G + L+ G+L+I+AVA Sbjct: 260 DSITAVVLGGTSLFGGRGSISGTLLGALIVGVFRNGLTLIGVSSVYQVLITGMLVILAVA 319 Query: 351 IDQ 353 D+ Sbjct: 320 ADK 322 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 328 Length adjustment: 29 Effective length of query: 331 Effective length of database: 299 Effective search space: 98969 Effective search space used: 98969 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory