Align Inositol transport system sugar-binding protein (characterized)
to candidate BPHYT_RS12000 BPHYT_RS12000 sugar ABC transporter substrate-binding protein
Query= reanno::Phaeo:GFF715 (316 letters) >FitnessBrowser__BFirm:BPHYT_RS12000 Length = 351 Score = 312 bits (800), Expect = 7e-90 Identities = 158/336 (47%), Positives = 215/336 (63%), Gaps = 28/336 (8%) Query: 9 MLATTVAAAPMMLATTASAEGEKYILVSHAPDSDSWWNTIKNGIALAGEQMNVEVEYRNP 68 ++A A A A ++LVSHAPDSD++WNTI+N I A E NVE +YRNP Sbjct: 16 LVAALALTAGFAAQPAARAVDAHFVLVSHAPDSDTFWNTIRNAIEQADEDFNVETDYRNP 75 Query: 69 PTGDLADMARIIEQAAASGPNGIITTLSDYDVLSGPIKAAVDSGVDVIIMNSGTPDQARE 128 P GDLADM+R+IEQAAA +G+ITT++D+DVL I+ + ++ +NSGT +Q+ + Sbjct: 76 PNGDLADMSRLIEQAAARNYDGVITTIADFDVLKSSIEKVTAKKIALVTINSGTNEQSAQ 135 Query: 129 VGALMYVGQPEYDAGHAAGMRAKADGVGSFLCVNHYISSPSSTERCQGFADGLGVDLGDQ 188 + A+M++GQPEY AG AAG +AKA GV +FLCVNH+ ++P S +RC+GFAD +G D Sbjct: 136 LAAIMHIGQPEYLAGKAAGEKAKAAGVKTFLCVNHFATNPVSFDRCRGFADAIGADYKTS 195 Query: 189 MIDSGQDPAEIKNRVLAYLNTNPETDAILTLGPTSADPTLLALDENGMAGDIYFGTFDLG 248 IDSGQDP EI+++V AYL +P+TDA+LTLGP A TL A+D+ G+AG I+F TFD Sbjct: 196 TIDSGQDPTEIQSKVSAYLRNHPKTDAVLTLGPPPASATLKAIDQMGIAGKIFFCTFDFS 255 Query: 249 EEIVKGLKSGVINWGIDQQPFLQAYLPVVVL-------------------------TNYH 283 +EI K ++ G I + IDQQP+LQ Y+ V VL Sbjct: 256 DEIAKAIRDGTIAFAIDQQPYLQGYMAVAVLAIAKKERTTDPVKIRQVLKENVKFKARLE 315 Query: 284 RYGVLPG---NNINSGPGFVTKDGLEKVEEFAGEYR 316 YG+ P NI SGP F+TK L+KV ++AG+YR Sbjct: 316 MYGLEPSYGPKNIRSGPSFITKANLDKVVKYAGQYR 351 Lambda K H 0.315 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 351 Length adjustment: 28 Effective length of query: 288 Effective length of database: 323 Effective search space: 93024 Effective search space used: 93024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory