Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate BPHYT_RS25825 BPHYT_RS25825 ABC transporter permease
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__BFirm:BPHYT_RS25825 Length = 333 Score = 218 bits (556), Expect = 1e-61 Identities = 135/327 (41%), Positives = 196/327 (59%), Gaps = 8/327 (2%) Query: 1 MTAPSSPAPLATDKPRF---DLLAFARKHRTILFLLLLVAVFGAANERFLTARNALNILS 57 +TA +PL + R LL R + +L+ VF A+ FL+ N LNI Sbjct: 8 LTAERQASPLQKSRMRRIAQALLQGDRPYALYAAFAILLVVFSFASPWFLSIDNFLNIGR 67 Query: 58 EVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTL 117 + ++ IIA+GMTFVI+ ID++VGS LA + ++AA + A VG+ W+I + Sbjct: 68 QTALVSIIAIGMTFVIIARQIDLSVGSTLALSGMSAALAM-AYVGNN---WVIGAIAGIG 123 Query: 118 IGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGATLLLNDGGPISGFNDAY-RWWGSGEI 176 G G + G T +++P+F+VTLG ++ RG L++ P+ ND++ +G G+I Sbjct: 124 TGAIVGAINGIVTTRVNIPSFLVTLGTLSAARGLALMVTTTKPVIIDNDSFISIFGEGDI 183 Query: 177 LFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGA 236 +PVP++ L AG + L Y+ +GRQ+YA GGN AA SG+N +TT + + G Sbjct: 184 FGVPVPIIWTLLAVIAGILLLHYSVFGRQIYAAGGNPTAALYSGINTRRVTTLAFILTGM 243 Query: 237 LAGLSGFLLSARLGSAEAVAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLS 296 LAGL+ +LSAR +A G EL VIASV +GG SL GG G V GT+LG+L+IG L+ Sbjct: 244 LAGLAALVLSARSHAARPDVVQGMELDVIASVTLGGCSLFGGRGFVLGTLLGSLIIGTLN 303 Query: 297 NGLVMLHVTSYVQQVVIGLIIVAAVAF 323 NGLV+L V+S +Q V+ G+IIVAAVAF Sbjct: 304 NGLVLLGVSSSLQLVIKGVIIVAAVAF 330 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 333 Length adjustment: 28 Effective length of query: 304 Effective length of database: 305 Effective search space: 92720 Effective search space used: 92720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory