GapMind for catabolism of small carbon sources

 

Aligments for a candidate for iolD in Burkholderia phytofirmans PsJN

Align 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (ring-opening) (EC 3.7.1.22) (characterized)
to candidate BPHYT_RS13915 BPHYT_RS13915 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

Query= BRENDA::Q9L3I0
         (626 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13915 BPHYT_RS13915
           3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase
          Length = 657

 Score =  660 bits (1702), Expect = 0.0
 Identities = 351/618 (56%), Positives = 433/618 (70%), Gaps = 10/618 (1%)

Query: 14  TIRLTMAQAVAHFLKVQMTIV-DGKKV-PIFGGVWAIFGHGNVAGIGEALYQVREELTTY 71
           T+RLT AQA+  +L  Q     DG+   P+FGGV+AIFGHGNVAGIGEALYQ REEL T 
Sbjct: 26  TVRLTTAQALVRYLAAQRVATEDGEGTEPLFGGVFAIFGHGNVAGIGEALYQHREELPTL 85

Query: 72  RAHNEQGMAHAAIAYAKANFRTRFMACTSSIGPGALNMVTAAGVAHVNRIPVLFLPGDVF 131
           RAHNEQ MAH+AIAYAKA+FR R MA T+SIGPGA N+VTAA +AHVNR+PVL LPGD+F
Sbjct: 86  RAHNEQAMAHSAIAYAKAHFRRRMMAVTTSIGPGATNLVTAAALAHVNRLPVLLLPGDIF 145

Query: 132 ANRAPDPVLQQIEDSATASVSANDAFRSVSRYFDRITRPEQIITALKRAMQVLTDPLDCG 191
            +RAPDPVLQQ+ED     VSANDA + VSRYFDRI  P Q++ AL RA++VLTD   CG
Sbjct: 146 VSRAPDPVLQQVEDFHDGGVSANDALKPVSRYFDRIVHPAQLLNALPRAVRVLTDAALCG 205

Query: 192 PVTLSLCQDVQAEAYDYPESLFAEKVWTTRRPQPDADELANAIALIKASQKPVIVAGGGV 251
           PVTL+L QDVQA+A+D+P   F  +V T   P P ADE+  AIA ++ +++P+IVAGGG+
Sbjct: 206 PVTLALPQDVQAQAWDFPVDFFKPRVVTFYSPAPRADEIEAAIARLRHAKRPLIVAGGGL 265

Query: 252 LYSQATKELAAFAEAHGIPVVVSQAGKSAINETHPLALGSVGVTGTSAANAIAEETDLVI 311
           LY +AT  L  FA  HGIPV  +QAGK A+    PL  G++GVTG+ AANA+A + D V+
Sbjct: 266 LYGRATDALHRFATTHGIPVAETQAGKGALAWNDPLNAGALGVTGSPAANALAHDADCVL 325

Query: 312 AVGTRCQDFTTGSWALFKNDSLKMIGLNIAAYDAVKHDSHPLVADAREGLKALSAGLSGW 371
           A+GTR QDFTTGS  LF      +I +N  A+D +K  +  + ADAR  L+AL+  L GW
Sbjct: 326 AIGTRLQDFTTGSNTLF--TQADVIAVNANAFDGLKQRAQVVEADARLALEALAEPLQGW 383

Query: 372 KAPAALAEKAAAEKKIWMEAAARA--MATTNAALPSDAQVIGAVARTIGGE--NTTVLCA 427
            A  A   +A      W +  +        +  LP +  VIGAV R+      N  V+CA
Sbjct: 384 HADRAWTARAHKLAASWRDTVSTLTHAPQRDTVLPYEGDVIGAVQRSSASSPTNDIVVCA 443

Query: 428 AGGLPGELHKLWPATAPGSYHMEYGFSCMGYEIAGGLGAKMARPERDVVVMVGDGSYMMM 487
           AG LP ELHKLW A  PG+YH+EYG+SCMGYEIAGGLG K+ARP R+V+VMVGDGSY+MM
Sbjct: 444 AGTLPAELHKLWRAGKPGAYHVEYGYSCMGYEIAGGLGVKLARPAREVIVMVGDGSYLMM 503

Query: 488 NSELATSVMLGLKLNIIVLDNRGYGCINRLQMGTGGANFNNLLKDSYHEVM--PEIDFRA 545
           NSE+ATSVM+G KL ++VLDNRGYGCINRLQ   GGA FNNLL++     +  P+IDF A
Sbjct: 504 NSEIATSVMIGAKLIVVVLDNRGYGCINRLQQACGGAPFNNLLENCMQGPLGAPKIDFAA 563

Query: 546 HAESMGAIAVKVASIAELEQALADSRKNDRTSVFVIDTDPLITTEAGGHWWDVAVPEVSS 605
           HA ++GA A   A++AEL  AL  +R  DRT V  IDTDP  TT+ GG WW+VAVPEVS+
Sbjct: 564 HARALGAQAEHAANVAELAAALQRARAADRTYVISIDTDPAHTTDEGGWWWEVAVPEVST 623

Query: 606 RSEVNRAHEAYVKARAAQ 623
           R  V  A   Y    AA+
Sbjct: 624 RPAVRDARAKYETQLAAR 641


Lambda     K      H
   0.318    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1057
Number of extensions: 39
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 626
Length of database: 657
Length adjustment: 38
Effective length of query: 588
Effective length of database: 619
Effective search space:   363972
Effective search space used:   363972
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory