Align Myo-inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate BPHYT_RS13885 BPHYT_RS13885 myo-inositol 2-dehydrogenase
Query= reanno::HerbieS:HSERO_RS12095 (330 letters) >FitnessBrowser__BFirm:BPHYT_RS13885 Length = 338 Score = 480 bits (1236), Expect = e-140 Identities = 237/327 (72%), Positives = 274/327 (83%) Query: 2 IDVAIFGAGRIGKIHAANIAAQAGVRLKYVCDVHAESAAELAQRHGAQVGRVEQVLDDSS 61 IDVA+FGAGRIGKIHAAN+A Q GVRLKYV DV+ E+AA LA HGAQV ++ + D+S Sbjct: 8 IDVAVFGAGRIGKIHAANLARQPGVRLKYVVDVNREAAAALAAEHGAQVADIDGAMGDAS 67 Query: 62 VAAVVIASSTDTHADLILRAAAAGKAIFCEKPVDLDLQRAQACAEAVRAAGVTCMIGFQR 121 + A VI SSTDTHADLIL++AA K +FCEKPVDL L+RA+ACA+AV AGV CMIGFQR Sbjct: 68 IGATVICSSTDTHADLILQSAAQKKHVFCEKPVDLTLERARACADAVERAGVVCMIGFQR 127 Query: 122 RFDPTFESLSRRLEAGEIGDPEMLLVTSRDPGAPPLSYIASSGGIFKDMLIHDFDIFRWI 181 RFDPTF +L RL+AGEIG PEML+VTSRDPGAPP+ YI SGGIFKDMLIHDFDIFRWI Sbjct: 128 RFDPTFSALKARLDAGEIGTPEMLVVTSRDPGAPPVEYIKHSGGIFKDMLIHDFDIFRWI 187 Query: 182 LADEAVSVFATGSCLTDPAIATAGDVDSTAVTLTTRSGRLCQINTSRRAAYGYDQRFEVL 241 L DEA ++ ATGSCL+DPAIA AGD+DSTAVT+ T+ GRLCQINT+RRAAYGYDQRFEVL Sbjct: 188 LDDEAETLHATGSCLSDPAIAEAGDIDSTAVTIRTKRGRLCQINTARRAAYGYDQRFEVL 247 Query: 242 GSKGMLQAGNHRPTEVVAATASQVGSDLPEHFFLERYRAAYAREMAHFFQAMQSGAPVRT 301 GS GMLQAGN RPTEV A + ++V SD+PE FFLERYRAAYA E+AHFF A+ G PVRT Sbjct: 248 GSHGMLQAGNVRPTEVTAYSKTEVSSDVPEAFFLERYRAAYAHEIAHFFDAVTHGKPVRT 307 Query: 302 SIEDGVKALQLAEAAATSWRERRIVSL 328 ++ DG+KAL+LAEAA SWRE R + L Sbjct: 308 TVADGLKALELAEAATRSWREGRAIKL 334 Lambda K H 0.321 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 338 Length adjustment: 28 Effective length of query: 302 Effective length of database: 310 Effective search space: 93620 Effective search space used: 93620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS13885 BPHYT_RS13885 (myo-inositol 2-dehydrogenase)
to HMM TIGR04380 (iolG: inositol 2-dehydrogenase (EC 1.1.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04380.hmm # target sequence database: /tmp/gapView.2039606.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04380 [M=330] Accession: TIGR04380 Description: myo_inos_iolG: inositol 2-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-130 418.8 0.8 6.9e-130 418.7 0.8 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS13885 BPHYT_RS13885 myo-inositol 2-deh Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS13885 BPHYT_RS13885 myo-inositol 2-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.7 0.8 6.9e-130 6.9e-130 2 330 .] 8 333 .. 7 333 .. 0.99 Alignments for each domain: == domain 1 score: 418.7 bits; conditional E-value: 6.9e-130 TIGR04380 2 lkigiiGaGRigkvHaenlakkvpeaelaavvdvaeeaakelaeklgieevvedveailedpevdAvlia 71 ++++++GaGRigk+Ha nla++ p+++l++vvdv++eaa++la++ g+ +v+d++ ++ d+ + A +i+ lcl|FitnessBrowser__BFirm:BPHYT_RS13885 8 IDVAVFGAGRIGKIHAANLARQ-PGVRLKYVVDVNREAAAALAAEHGA--QVADIDGAMGDASIGATVIC 74 689*******************.*************************..999***************** PP TIGR04380 72 sptdtHaeliveaakagkhifcEKPidldleeikealkavekagvklqiGfnRRFDanfaevkklveagk 141 s+tdtHa+li ++a+++kh+fcEKP+dl+le+++++++ave+agv ++iGf+RRFD++f+++k++++ag+ lcl|FitnessBrowser__BFirm:BPHYT_RS13885 75 SSTDTHADLILQSAAQKKHVFCEKPVDLTLERARACADAVERAGVVCMIGFQRRFDPTFSALKARLDAGE 144 ********************************************************************** PP TIGR04380 142 iGklellritsrDPapppveyvkvsGglflDmtiHDfDmarfllgseveevyaagsvlvdpeleeagdvd 211 iG++e+l +tsrDP +ppvey+k+sGg+f Dm iHDfD+ r++l++e e +a+gs+l dp+++eagd+d lcl|FitnessBrowser__BFirm:BPHYT_RS13885 145 IGTPEMLVVTSRDPGAPPVEYIKHSGGIFKDMLIHDFDIFRWILDDEAETLHATGSCLSDPAIAEAGDID 214 ********************************************************************** PP TIGR04380 212 tavvvlkfengalaviensrraayGYdqrvEvfGskGslraendtestvvlsdeegvraekpenfFleRy 281 +++v+++++ g+l+ i+ +rraayGYdqr Ev+Gs+G+l+a n+++++v+ +++++v+++ pe fFleRy lcl|FitnessBrowser__BFirm:BPHYT_RS13885 215 STAVTIRTKRGRLCQINTARRAAYGYDQRFEVLGSHGMLQAGNVRPTEVTAYSKTEVSSDVPEAFFLERY 284 ********************************************************************** PP TIGR04380 282 aeayraeikafvdailedkevsvtaeDglkalklalaakrsleegravk 330 ++ay++ei++f+da++++k+v t+ Dglkal+la+aa+rs +egra+k lcl|FitnessBrowser__BFirm:BPHYT_RS13885 285 RAAYAHEIAHFFDAVTHGKPVRTTVADGLKALELAEAATRSWREGRAIK 333 *********************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.29 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory