Align D-mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate BPHYT_RS28515 BPHYT_RS28515 mannonate dehydratase
Query= metacyc::MONOMER-17955 (360 letters) >FitnessBrowser__BFirm:BPHYT_RS28515 Length = 350 Score = 399 bits (1025), Expect = e-116 Identities = 195/353 (55%), Positives = 248/353 (70%), Gaps = 12/353 (3%) Query: 3 LVFRWYGEKHDTVTLEQIRQIPGVEGVVGALFDIPVGEVWPFEEIMKLKETVEKAGLKLE 62 + FRWYG+ D V L IRQIPG+ GVV A++D+PVGEVWP + I LKE +E GL LE Sbjct: 1 MTFRWYGDT-DPVPLAYIRQIPGMVGVVSAIYDVPVGEVWPIDRIRSLKEKIEAHGLTLE 59 Query: 63 VIESVNVHEDIKLGLPTRDRYIENYKKTIRNLAKAGVKVVCYNFMPVFDWMRTDLHKKLP 122 VIESV VHEDIKLG PTRD I NY +T+RNL GVKVVCYNFMPVFDW RT L LP Sbjct: 60 VIESVPVHEDIKLGKPTRDTLIVNYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMPLP 119 Query: 123 DGSETMEYDHRLIEGVTPDELIKRVKEGSQGFVLPGWEWD-RLEKLRETFELYKNVDEEK 181 DGS T+ +D + I R + S+G LPGW+ R E+L+ Y+ +DE Sbjct: 120 DGSTTLAFDTQAI----------RELDVSEGIQLPGWDASYRPEQLKALLRDYEALDEAG 169 Query: 182 LFENLVYFLERVIPVCEECDVKLAIHPDDPPWSIFGLPRIITNKENIERMLKAVDSPYNG 241 L+ NL YFL +IPV +E +K+AIHPDDPP IFGLPRI+ N+ +++R+L VD P NG Sbjct: 170 LWANLDYFLRAIIPVAKEAGIKMAIHPDDPPRPIFGLPRIVKNRADLQRVLDIVDDPANG 229 Query: 242 ITFCMGSLGANPENNIPEMIRYFGKMGRIHFAHVRNLKFTGEKSFYETAHPSFCGSHDLF 301 +T C GSLGA+ +N+IP ++R FG GRIHFAH+RN++ F+ET+H S GS D+ Sbjct: 230 LTLCSGSLGADLQNDIPALVREFGARGRIHFAHLRNVQTNAAGDFHETSHRSADGSLDMA 289 Query: 302 EVMKAFHDIGYEGYIRPDHGRLIWGEKARPGYGLYDRALGATYILGLWEAIDK 354 E++KA+ + G+EGY RPDHGR+IWGE R GYGL+DRALGA Y+ G+WE + K Sbjct: 290 EIVKAYFETGFEGYARPDHGRMIWGETGRAGYGLFDRALGAVYLNGIWEGLAK 342 Lambda K H 0.322 0.142 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 350 Length adjustment: 29 Effective length of query: 331 Effective length of database: 321 Effective search space: 106251 Effective search space used: 106251 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS28515 BPHYT_RS28515 (mannonate dehydratase)
to HMM TIGR00695 (uxuA: mannonate dehydratase (EC 4.2.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00695.hmm # target sequence database: /tmp/gapView.3450.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00695 [M=394] Accession: TIGR00695 Description: uxuA: mannonate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-124 400.6 0.0 3.1e-66 210.0 0.0 2.0 2 lcl|FitnessBrowser__BFirm:BPHYT_RS28515 BPHYT_RS28515 mannonate dehydrat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS28515 BPHYT_RS28515 mannonate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.7 0.0 9.4e-60 9.4e-60 3 138 .. 1 137 [. 1 139 [. 0.98 2 ! 210.0 0.0 3.1e-66 3.1e-66 180 389 .. 142 342 .. 138 346 .. 0.94 Alignments for each domain: == domain 1 score: 188.7 bits; conditional E-value: 9.4e-60 TIGR00695 3 qtfrwyGrndpvsledvrqa.GakGivtalhhipnGevweveeikkrkeeiedaGlsasvvesvpvheei 71 +tfrwyG dpv l+++rq+ G+ G+v a++++p+Gevw ++ i+ ke+ie Gl+ +v+esvpvhe+i lcl|FitnessBrowser__BFirm:BPHYT_RS28515 1 MTFRWYGDTDPVPLAYIRQIpGMVGVVSAIYDVPVGEVWPIDRIRSLKEKIEAHGLTLEVIESVPVHEDI 70 79******************************************************************** PP TIGR00695 72 klqteeyekyienykqtlrnlaqcGikvvcynfmpvldwtrtdlayeledGskalrfdkikvaalel 138 kl++ ++ i ny qtlrnl cG+kvvcynfmpv+dwtrt l+ +l+dGs++l fd ++ l++ lcl|FitnessBrowser__BFirm:BPHYT_RS28515 71 KLGKPTRDTLIVNYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMPLPDGSTTLAFDTQAIRELDV 137 ***********************************************************99998875 PP == domain 2 score: 210.0 bits; conditional E-value: 3.1e-66 TIGR00695 180 glpGaeegekldrikelleaykdideeklrenlafflkeilpvaeevGvkmaihpddpprpilGlprivs 249 lpG++ ++ +++k ll y +de+ l+ nl +fl++i+pva+e G+kmaihpddpprpi+Glpriv lcl|FitnessBrowser__BFirm:BPHYT_RS28515 142 QLPGWDASYRPEQLKALLRDYEALDEAGLWANLDYFLRAIIPVAKEAGIKMAIHPDDPPRPIFGLPRIVK 211 59******************************************************************** PP TIGR00695 250 tiedmkklveisdspangitlctGsyGvradndlvelakqfa..driyfahlrsvkreenpktfheaahl 317 +d++++ +i+d pang+tlc+Gs+G+ +nd+ l+++f+ +ri+fahlr+v+ + + +fhe++h lcl|FitnessBrowser__BFirm:BPHYT_RS28515 212 NRADLQRVLDIVDDPANGLTLCSGSLGADLQNDIPALVREFGarGRIHFAHLRNVQTNAAG-DFHETSHR 280 *****************************************94457************999.******** PP TIGR00695 318 ekdvdlyevvkavleeehrrkaeGkedlipvrpdhGrqllddlkkktnpGysaigrlkGlaelrGlelal 387 + d++l + +++ + eG + rpdhGr +++ + + Gy++++r++G ++l+G++ l lcl|FitnessBrowser__BFirm:BPHYT_RS28515 281 SADGSLD--MAEIVKAYFETGFEG----Y-ARPDHGRMIWG---ETGRAGYGLFDRALGAVYLNGIWEGL 340 **99877..666677777778899....6.8**********...99*********************987 PP TIGR00695 388 kk 389 k lcl|FitnessBrowser__BFirm:BPHYT_RS28515 341 AK 342 65 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (350 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 3.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory