GapMind for catabolism of small carbon sources

 

Aligments for a candidate for boxA in Burkholderia phytofirmans PsJN

Align Benzoyl-CoA oxygenase component A; Benzoyl-CoA 2,3-dioxygenase subunit A; Benzoyl-CoA dioxygenase reductase component; EC 1.14.13.208 (characterized)
to candidate BPHYT_RS13335 BPHYT_RS13335 benzoyl-CoA oxygenase

Query= SwissProt::Q9AIX6
         (414 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13335 BPHYT_RS13335 benzoyl-CoA
           oxygenase
          Length = 413

 Score =  522 bits (1345), Expect = e-153
 Identities = 259/420 (61%), Positives = 302/420 (71%), Gaps = 13/420 (3%)

Query: 1   MNAPAEHANLARQHLIDPEICIRCNTCEEICPVDAITHDSRNYVVKFETCNGCLACISPC 60
           MN P     + RQHLIDPEICIRCNTCEE CPVDAITHD  NYVVK E CNGC+AC+ PC
Sbjct: 1   MNGPVS-IEVLRQHLIDPEICIRCNTCEETCPVDAITHDDNNYVVKAEICNGCMACVPPC 59

Query: 61  PTGAIDSWRNVDKATPHSLADQYSWDYLPDTTELDQFEATVMGAAELPAEVQQITEVATA 120
           PTGAID+WR V KA  + + +Q++WD LP+   +      V  A ELP        VA A
Sbjct: 60  PTGAIDNWRTVLKADAYPIEEQFTWDVLPEQNTM-----AVPAADELPGAGASGDTVAEA 114

Query: 121 GQ------GGPAMAPWSASHPYVNLYTPANPITATVTGNYRLTAEDASSDIHHIVLDFGT 174
                    G  + PWSA+ PYVNLYT   P +ATV GNYRLT     SDIHHIVLDFG+
Sbjct: 115 SGIEVDTVRGSVVPPWSAAKPYVNLYTHKEPTSATVVGNYRLTDGSTDSDIHHIVLDFGS 174

Query: 175 TPFPVLEGQSIGIIPPGVDEKGKPHLLRMYSVASPRDGERPHYNNLSLTVKRVVEDHEGN 234
            PFPVLEGQSIGI+PPG    G+ H  R YS+ASPRDGERP YNN+SLTVKRV + H G+
Sbjct: 175 MPFPVLEGQSIGILPPGTAADGRAHHARQYSIASPRDGERPGYNNVSLTVKRVSQQH-GD 233

Query: 235 PTRGVASNYVCDLKKGDKVQVTGPYGSTYLMPNHPGSSIMMICTGTGSAPMRAMTERRRR 294
              GV SNY+CDLKKGD V+V GP+G T+LMPNHP S ++MICTGTGSAPMRAMTE RRR
Sbjct: 234 SLDGVCSNYLCDLKKGDVVKVIGPFGGTFLMPNHPNSHLLMICTGTGSAPMRAMTEYRRR 293

Query: 295 RMDRKEGGELVLFFGARAPEELPYFGPLQKLPKEFIDINFAFSRVPGEPKRYVQDAIRER 354
           R  +   G+L+LFFGAR  EELPYFGPL  LPK+FID N AFSR PG+PKRYVQDA+RER
Sbjct: 294 RRLKGATGKLMLFFGARTKEELPYFGPLTNLPKDFIDTNLAFSRTPGQPKRYVQDAMRER 353

Query: 355 ADKVFQMLQDDNCYIYICGLKGMEAGVLEAFRDICRAKGADWDALRPQLLSKARFHVETY 414
           A  V  ML+DDN +IY+CGLKGME GVL+A ++I      DW+AL  +L  + R H+ETY
Sbjct: 354 AVDVAHMLKDDNTHIYVCGLKGMEDGVLQALKEIGERHQLDWEALWVKLKKEGRLHLETY 413


Lambda     K      H
   0.319    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 586
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 414
Length of database: 413
Length adjustment: 31
Effective length of query: 383
Effective length of database: 382
Effective search space:   146306
Effective search space used:   146306
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory